Providencia vermicola: G3341_13110 Help Entry G3341_13110       CDS       T06449                                  Symbol flgM Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pvc  Providencia vermicola Pathway pvc02020   Two-component system pvc02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pvc00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     G3341_13110 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     G3341_13110 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pvc02035]     G3341_13110 (flgM) Bacterial motility proteins [BR:pvc02035]  Flagellar system   Flagellar assembly proteins    Others     G3341_13110 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  QIC16559 UniProt:  A0A8E3VT61 LinkDB All DBs Position 2890735..2891037 Genome browser AA seq 100 aa AA seqDB search MAIEQTSAISALTQVTNRDPQDPAAQLREKKVSEAESVKESTFSPSELKKKLLQPQASDI NSEKVERIKQAIKEGTLQMDAGKIADGILRDAHECMLAMK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctattgagcaaacatctgcaatttcagcgttaacgcaagtcacaaaccgtgaccct caagatcctgcggcacaacttcgtgagaaaaaagtctcagaagccgaatcagtcaaagaa agtactttttcaccaagtgaactcaaaaagaaattactccagcctcaggcgagcgatatt aatagtgaaaaggttgaaagaattaagcaagccattaaagagggaacattgcaaatggat gcaggaaaaattgctgacggtattttacgcgatgcccatgaatgtatgctggcgatgaaa taa

DBGET integrated database retrieval system