Pseudomonas viridiflava: CFBP1590__3947 Help Entry CFBP1590__3947    CDS       T06554                                  Name (GenBank) unnamed protein product   KO K02078   acyl carrier protein Organism pvd  Pseudomonas viridiflava Pathway pvd00998   Biosynthesis of various antibiotics pvd01100   Metabolic pathways pvd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pvd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CFBP1590__3947   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CFBP1590__3947 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 PP-binding_2 PRD Motif Other DBs NCBI-ProteinID:  SMS11533 UniProt:  A0A1Y6JT95 LinkDB All DBs Position I:4392050..4392295 Genome browser AA seq 81 aa AA seqDB search MKKEDIENRIKKIIAHQLSVDASTLAEHQSLSSDLGAESLDIPDIIMALEEEFNIELPDD EIDGATTLGKIANRVSDKNPE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaggaagatattgaaaaccgcataaaaaagataatagcacaccaactctccgtt gacgcatcaacgctcgcagagcatcagagcctttcatctgatctaggagcagaatcgctc gacattcccgacatcatcatggctttggaagaagagttcaacatcgagctacccgacgac gagattgatggcgctaccacattaggcaaaatcgctaatagggtaagcgataaaaaccct gaataa

DBGET integrated database retrieval system