KEGG   Proteus mirabilis CYPV1: AOB99_07975Help
Entry
AOB99_07975       CDS       T04093                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pvl  Proteus mirabilis CYPV1
Brite
KEGG Orthology (KO) [BR:pvl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AOB99_07975
Enzymes [BR:pvl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AOB99_07975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 HI0933_like FAD_oxidored Thi4 FAD_binding_3 DAO AlaDh_PNT_C NAD_binding_8 K_oxygenase FMO-like Glutaredoxin Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ALE25314
UniProt: A0A5F0RVW4
LinkDB All DBs
Position
1746995..1748560
Genome map
AA seq 521 aa AA seqDB search
MLDNNLKAQLKAYLERLTQPVELVATLDDSKHSADIQALLKEIEPLSDKVTYREDNSANV
RKPSFLITNPGKTTGVRFAGSPLGHEFTSLVLALLQTGGHPSKEAPELLEQIRQLDGEFH
FETYYSLSCHNCPDVVQALNLMAILNPNITHTAIDGGMFQNEIQERNIMGVPAVFLNGNE
FGQGRMTLAEIVSKVDSNAEKRTAELLNKKDAFDVLIVGSGPAGASAAVYAARKGLNTGL
IGERFGGQVLDTVDIENYISVPKTEGAKLAGALKAHVDDYQVDVIDSQTVSRLIPGAAEG
DLHQIETASGAILKTRSLIIATGARWRNMNVPGENEYRTRGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVEHVTVLEFASEMRADAVLQKKLRSLSNVDVILNAQTTEVYGD
GTKLTGLKYKDRTNDSMHDIALAGIFVQIGLLPNTQWLDGTVERNKIGEIVVDSRGETNI
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTTAK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagataataatttaaaagctcaactgaaagcttacctagaacgattaacccagcca
gttgagttagttgcaacattagacgacagcaaacattctgctgatatccaagccttatta
aaagaaattgaaccgttatctgataaagtcacataccgtgaagataacagtgctaatgtg
cgcaaaccatcttttcttattaccaacccagggaaaacaactggcgttcgttttgcaggc
tcgccattaggtcatgagtttacttctttagtattagcattattacaaaccggtggtcat
ccatctaaagaagccccagaattacttgaacaaattcgtcagttagacggtgagtttcat
ttcgaaacctattattcgctctcttgtcataactgccctgatgttgttcaggcattaaac
ttaatggcgattttaaatccgaacatcacccatacggcgatcgacggaggcatgttccaa
aatgaaattcaggaacgtaatatcatgggcgttcctgcggtattcttaaatggcaacgag
tttggccaaggtcgtatgactttagctgaaattgttagcaaagtagatagcaatgcagaa
aaacgcactgcagagttactaaataaaaaagatgcctttgatgttctgattgtcggaagc
ggccctgcaggggcgtcagcggcagtatatgctgcacgtaaaggcttaaatacaggtctt
atcggtgaacgttttggtggacaagttcttgatactgttgatattgaaaactatatctct
gtacctaaaacagaaggtgcaaaattagctggggctttaaaagctcatgttgatgattat
caagttgatgtcattgacagccaaactgtcagccgtttaattccgggagcagcggaaggt
gatctacaccaaattgaaaccgcatctggtgcgattttaaaaacccgtagcttaattatt
gccacgggtgctcgctggagaaatatgaacgtaccgggtgaaaacgagtaccgtactcgc
ggtgtaacatactgcccacattgtgatggtcctctatttaaaggtaaaagagtggctgtt
attggtggcggtaactccggtgttgaagctgctattgacttagcaggtttagtggagcac
gtgaccgtactagaatttgcctcagaaatgagagccgatgctgttttacaaaagaaactg
cgtagcttaagtaatgtcgatgttatcttaaatgcccaaacaacagaagtatatggagat
ggcactaagttaacagggctgaaatataaagatcgcactaacgattcaatgcatgatatt
gccttagcgggtattttcgtccaaattggtttactgccaaacacacaatggttagacgga
actgttgagcgtaataaaattggtgagatcgtggttgattcacgtggtgaaaccaatatt
aaaggggtatttgctgcgggtgactgtacaactgttccttataaacaaattattatcgcc
gcgggtgaaggtgcaaaagcctcattaagcgcctttgattacttaattcgcacaacggca
aaataa

DBGET integrated database retrieval system