KEGG   Pectobacterium wasabiae: A7983_05150Help
Entry
A7983_05150       CDS       T04535                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pws  Pectobacterium wasabiae
Brite
KEGG Orthology (KO) [BR:pws00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pws03012]
    A7983_05150
   03029 Mitochondrial biogenesis [BR:pws03029]
    A7983_05150
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pws04147]
    A7983_05150
Translation factors [BR:pws03012]
 Eukaryotic Type
  Elongation factors
   A7983_05150
 Prokaryotic Type
   A7983_05150
Mitochondrial biogenesis [BR:pws03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A7983_05150
Exosome [BR:pws04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A7983_05150
  Exosomal proteins of breast cancer cells
   A7983_05150
  Exosomal proteins of colorectal cancer cells
   A7983_05150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: AOR62659
UniProt: J8Q0N6
LinkDB All DBs
Position
complement(1139959..1141143)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GEAEWEAKIVELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccccacgttaacgtcggtactatcggccac
gttgaccatggtaaaacgactctgactgctgcaatcactaccgttctggctaaaacctac
ggtggtaacgcacgtgcattcgaccagatcgataacgcaccagaagaaaaagcacgtggt
atcaccatcaacacgtctcacgttgaatacgataccccgtctcgccactatgcgcacgtt
gactgcccaggacacgccgactatgtgaaaaacatgatcaccggtgctgcccagatggat
ggcgcgatcctggttgttgctgcaactgacggcccgatgcctcagactcgtgagcacatc
ctgctgggtcgtcaggttggcgttcctttcatcatcgtgttcctgaacaaatgtgacatg
gttgatgacgaagagctgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgatttccctggcgacgacacgccggtaattcgtggctctgctctgaaagcgctggaa
ggcgaagccgagtgggaagcgaaaatcgtcgaactggctggctacctggattcttatatc
ccagaaccagagcgtgcaattgacaagccgttcctgctgccaatcgaagacgtattctct
atctccggccgtggtactgttgttactggtcgtgtagagcgcggtatcgttaaagtcggt
gaagaagttgaaatcgttggtatcaaagatactgcgaaatcgacctgtactggcgtagaa
atgttccgcaaactgctggacgaaggtcgtgcaggcgagaacgttggtgttctgctgcgt
ggtatcaagcgtgaagaaatcgagcgtggccaagtactggctaagccgggttcaatcaag
ccgcacacccagttcgaatcagaagtgtatatcctgagcaaagatgaaggcggccgtcat
actccgttcttcaaaggctaccgtcctcagttctacttccgtaccactgacgtaacgggt
accatcgaactgccagaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccaatcgcgatggatgacggtttgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgcgggcgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system