KEGG   Phenylobacterium zucineum: PHZ_c2725Help
Entry
PHZ_c2725         CDS       T00750                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, subunit f
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pzu  Phenylobacterium zucineum
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PHZ_c2725 (ahpF)
Enzymes [BR:pzu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PHZ_c2725 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO FAD_binding_3 AlaDh_PNT_C Glutaredoxin NAD_binding_8 NAD_binding_7 K_oxygenase FMO-like Thi4
Motif
Other DBs
NCBI-ProteinID: ACG79134
UniProt: B4RHU3
LinkDB All DBs
Position
3121234..3122817
Genome map
AA seq 527 aa AA seqDB search
MLDDNLKAQLRAYLENIRQPVELVASLDDGAKSKELLELLEEIAAASDKVRVVTGGDDAR
KPSFAIVRAGTDVSVRFAGLPLGHEFTSLVLTLLWVGGHPPKVEPEVIEQVKALDGDFSF
ETYFSLSCQNCPDVVQALNLMSVLNPKIRHVSIDGALFQDEVEKRQVMAVPTVLLNGEPF
AQGRMELGQILAKIDTGAQARAAEKIKGKDAFDVLVVGGGPAGAAAAIYAARKGIRTGLA
AERFGGQVLDTLAIENFISVPHTEGPKLAAGLEQHVKDYDVDVMNLQKATKLVPAREPGG
LITVELENGASLKSRTVILATGARWRQMNVPGEDAYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVRIVTSALTTEVKGDG
QKVTGLVYKDRNSDEVHNVDLEGIFVQIGLVPNTEWLKDSVALSPRGEIETDYRGQTSIP
GVFAAGDATTTPYKQIVIAMGEGSKAALSAFDYLIRQPVPAQSQAAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgacaatctgaaggcccagctgcgggcctatctggagaacatccgccagccg
gtggagctggtggcctcgctggacgacggcgccaagtccaaggagctgctcgagctcctg
gaagagatcgccgccgcctcggacaaggtgcgcgtggtcaccggcggcgacgacgcccgc
aagccctcgttcgccatcgtgcgggccgggaccgacgtttccgtgcgcttcgcgggcctc
ccgctcggccacgagttcacctcgctggtgctgaccctgctgtgggtcggcggccatccg
cccaaggtggagcccgaggtgatcgaacaggtgaaggcgctcgacggcgacttctcgttc
gagacctatttctcgctctcgtgccagaactgccccgacgtggtgcaggcgctgaacctg
atgagcgtgctgaacccgaagatccgccacgtctccatcgacggggccctgttccaggac
gaagtcgagaagcgccaggtcatggcggttcccaccgtgctgctgaacggcgagccgttc
gcgcaagggcgcatggagctcggccagatcctcgccaagatcgacaccggcgcccaggcc
cgcgcggccgagaagatcaagggcaaggacgccttcgacgtgctggtggtgggcggcggc
ccggccggcgcggccgcggccatctacgccgcccgcaagggcatccgcacgggcctcgcc
gccgaacgcttcggcggtcaggtgctcgacaccctggcgatcgagaacttcatctcggtg
ccgcacaccgaagggcccaagctggcggccggcctcgagcagcacgtcaaggactacgac
gtcgacgtgatgaacctgcagaaggcgaccaagctggtcccggcccgcgagccgggcggc
ctgatcaccgtcgagctggagaacggcgcctcgctgaagtcgcggaccgtcatcctcgcc
accggcgcccgctggcggcagatgaacgtccccggcgaggacgcctaccgcaacaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtcgaggcggccatcgacctggccggcatcgtggcccacgtc
accctgatcgagttcgacagccagctgcgcgccgacgccgtgctgcagcgcaagctggcc
agcctgccgaacgtgcgcatcgtcacctcggccctgaccaccgaggtcaagggcgacggc
cagaaggtgaccggcctcgtctacaaggaccgcaactcggacgaggtgcacaacgtcgac
ctggaggggatcttcgtccagatcggcctggtgccgaacaccgagtggctgaaggactcg
gtggcgctctcgccgcgcggcgagatcgagaccgactaccgcggccagacctcgatcccg
ggcgtgttcgcggccggcgatgcgaccaccacgccctacaagcagatcgtcatcgccatg
ggcgagggctcgaaggcggcgctgtcggccttcgactacctgatccgccagccggtcccg
gcgcagtcgcaggccgcggcctga

DBGET integrated database retrieval system