KEGG   Rahnella aquatilis HX2: Q7S_00200Help
Entry
Q7S_00200         CDS       T01850                                 

Definition
(GenBank) manganese/iron superoxide dismutase-like protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
raa  Rahnella aquatilis HX2
Brite
Enzymes [BR:raa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Q7S_00200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N TGF_beta_GS
Motif
Other DBs
NCBI-ProteinID: AFE56312
UniProt: H8NM04
LinkDB All DBs
Position
complement(45307..45927)
Genome map
AA seq 206 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKETMEIHHTKHHQAYVNNANAALESLPELAALPVEELITK
LDQVPADKKVALRNNAGGHANHSLFWKGLKTGTTLQGELKSAIERDFGSVDAFKETFEKA
ATTRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAISGASGYPLLGLDVWEHAYYLKYQN
KRPDYIKAFWAVVNWDEAAKRLAEAK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcactgccttacgcatacgacgcactcgaaccgcatttcgac
aaagaaacgatggaaatccatcacactaaacatcaccaggcttacgtgaacaacgctaac
gctgcgctggaaagcttgccggaactggctgcactgccggttgaagaactgatcaccaaa
ctggatcaggttcctgcagacaagaaagttgcactgcgtaacaacgcaggcggccacgct
aaccacagcctgttctggaaaggcctgaaaaccggcaccaccctgcagggcgaactgaaa
tctgcgatcgaacgcgatttcggcagcgttgacgctttcaaagaaacttttgagaaagca
gcgaccactcgtttcggttcaggctgggcatggctggtgctgaaagacggcaaactggcg
gttgtttctactgctaaccaggacagcccgctgatgggcgaagccatttccggcgcttcc
ggttacccgctgctgggcctggacgtgtgggaacacgcttactacctgaaatatcagaac
aaacgccctgattacatcaaagccttctgggctgttgtaaactgggacgaagcagcaaaa
cgtctggctgaagcgaagtaa

DBGET integrated database retrieval system