KEGG   Raineyella sp. CBA3103: Rai3103_08830Help
Entry
Rai3103_08830     CDS       T06259                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rain  Raineyella sp. CBA3103
Brite
KEGG Orthology (KO) [BR:rain00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rai3103_08830 (ahpF)
Enzymes [BR:rain01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Rai3103_08830 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 K_oxygenase AlaDh_PNT_C Glutaredoxin NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: QGF23759
UniProt: A0A5Q2FAC8
LinkDB All DBs
Position
1945971..1947551
Genome map
AA seq 526 aa AA seqDB search
MLDATLKTQLKEQYFTKLTEPVELVSSLDDRPKSREMAELLDELAGLSALVTHRRADDDE
RRPSFAITRPGSDISIRFAGIPMGHEFSSLVLALLQVGGVPVKEDAETLEAVANLEGDFE
FVTYMSLSCQNCPTVVQALNSMAVLNPQIKHTAVEGSLFQDEIEERRILAVPTIYLNGEE
WGSGRTDMKQFVERLDHHAASRTAEKLNAREPYDVLVVGGGPAGASAAIYAARKGIRTGM
VCDRIGGQVLDTLAIENHVSQVYTEGPKLGAAYAEHMNAYDIDQIAGVQATRLIPGEDGE
LHTVEFEGGGRLQAQSVILATGARWRTLGVPGEADYRNKGVSFCPHCDGPLFKGKPIAVV
GGGNSGVEAAIDLAGVTEHVTVIEFLDQLKADEVLLRKLHSLPNTEVVTSARTTQVDGDG
RAMTSLQYEDRETGELRTLDVAGVFVQIGLLPNTEWLKGSIPLSPRGEVIITEKGETAIP
GIYAAGDCTTVPFKQIVIAEGSGATAALAAFEHMIRTTAPVPAAAL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaccctcaagacccagctcaaagagcagtacttcaccaagctcaccgag
cccgtcgaactcgtcagctccctggacgaccgtccgaagtcgcgggagatggccgagctg
ctcgacgagctcgccggcctctcggccctggtcacccaccgccgggccgacgacgacgag
cgccggccctccttcgccatcacccgcccgggtagcgacatctccatccgcttcgccggc
attccgatggggcatgagttcagctccctcgtcctggccctcctgcaggtcggcggcgtc
cccgtcaaggaggatgcggagaccctcgaagcggtcgccaacctcgagggtgacttcgag
ttcgtcacctacatgtcgctgagctgtcagaactgcccgaccgtcgtccaggccctgaac
tcgatggccgtcctcaacccgcagatcaagcacaccgccgtcgaggggtcactcttccag
gacgagatcgaggagcgccgcatcctcgcggtcccgacgatctacctcaacggcgaggag
tggggctccgggcgtacggacatgaagcagttcgtcgaacgcctcgaccaccacgccgcg
tcgcggaccgccgagaagctcaacgcccgcgaaccgtacgacgtcctcgtcgtcggtggc
ggcccggccggcgcctccgccgcgatctacgccgctcgcaagggcatccgcaccggcatg
gtctgtgatcggatcggcggccaggtgctcgacaccctggccatcgagaaccatgtctcg
caggtctacaccgagggccccaagctcggcgcggcctacgccgaacacatgaacgcgtac
gacatcgaccagatcgccggagtgcaggccacccgcctcatcccgggcgaggacggcgag
ctgcacacggtcgagttcgagggtggtggccggctccaggcgcagagcgtcatcctggcc
accggcgcccgctggcgtacgctcggcgtccctggtgaggcggactaccgcaacaagggc
gtctcgttctgcccgcactgtgacgggcccctgttcaagggcaagccgatcgccgtcgtc
ggcggtggcaactccggtgtcgaggcggcgatcgacctggccggcgtcaccgagcacgtc
accgtcatcgagttcctcgaccagctcaaggccgatgaggtgctgctccgcaagttgcac
agcctgcccaacaccgaggtcgtcacgtcagcgcgcaccacgcaggtggacggcgacggg
cgcgccatgacctccctgcagtacgaggatcgcgagaccggcgagctgaggaccctcgac
gtcgccggcgtcttcgtccagatcggtctgctgcccaacaccgagtggctgaagggatcg
atcccgctcagcccgcgcggtgaggtcatcatcaccgagaagggcgagacggccatcccg
ggcatctacgccgccggtgactgcaccactgtcccgttcaagcagatcgtgatcgccgag
ggctccggtgccaccgcggcgctcgccgccttcgagcacatgatccgcaccacggcgccg
gtcccggccgccgcgctctga

DBGET integrated database retrieval system