KEGG   Raoultella sp. X13: DSD31_02625Help
Entry
DSD31_02625       CDS       T05540                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
rao  Raoultella sp. X13
Pathway
rao00040  Pentose and glucuronate interconversions
rao00051  Fructose and mannose metabolism
rao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DSD31_02625
   00051 Fructose and mannose metabolism
    DSD31_02625
Enzymes [BR:rao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     DSD31_02625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 ADH_N_2 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AXC28429
LinkDB All DBs
Position
534379..535401
Genome map
AA seq 340 aa AA seqDB search
MAFETDIPDSQRALFLMAKETLELQTTAVPQPQAGEVLLKIGSVGVCGSDKHFYFDGRCG
SEMITAPMIMGHEFGGAIVAVGQGISPHRVGQRVSVDPLVPCGRCRHCVQGNYNICPTQK
FFGVPGTYGAMQQYLCVPSGNAHAISDAISDGAAAMVETISVALAGAQKGRIGLGSRVLI
TGGGPVGLFAVQVAKTLGATEVVLVEPQEGRRKIAHELGAETLSTLADNDRQYDVLLECT
GVQSVRHDACLSVLSGGRAIIIGVGEQVGGFPMSAVIEREVTIHGVMRYKFTWPAVIAAL
EEQRLNADILISRRLPLARAQEAWTLPMTNEIKTMIDVNA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaaacagatattccggacagccagcgtgcgctgttcctgatggcgaaagaa
acccttgagctacagactaccgccgtgccgcagccgcaggccggggaagtgctgctgaaa
atcggctcggtcggcgtgtgcggttcggataagcatttttacttcgacggccgctgcggc
agcgaaatgattaccgcgccgatgattatgggacacgagtttggcggggcgattgtggcg
gtggggcagggaatttcgccgcaccgcgtcgggcagcgcgtatcggtggatccgctggta
ccctgcggccgctgccggcactgtgtgcagggcaattataatatctgtccgacgcagaag
tttttcggcgtaccgggtacctatggcgccatgcagcagtatctgtgcgtcccgtcaggc
aacgcgcacgctatcagcgacgccattagcgacggcgcggcggcgatggttgaaacgatt
tcagtcgctctggcaggggcgcaaaaaggacggattggtctggggtcccgcgtgttaatc
accggcggcggcccggtggggttattcgccgttcaggtcgctaaaacgctgggcgccacg
gaagtggtactggttgagcctcaggaggggcggcgcaaaattgcccatgagctgggggct
gaaacgctgagtactctggccgataacgaccggcagtatgacgtgctgcttgaatgcacg
ggcgtacagtccgtgcgccacgacgcctgtctgagcgtactttccggcgggcgggcaatc
ataatcggcgtgggtgaacaggtgggcggctttcccatgtcggcagtgatagaacgtgaa
gtcaccattcacggggtgatgcgctataagttcacctggcctgcggttatcgcggctctg
gaggagcagaggctgaacgccgatattttgatcagccgacgtttgccgctggcgcgcgcc
caggaagcatggacgctcccgatgacgaatgaaattaagacgatgatcgacgttaacgcc
tga

DBGET integrated database retrieval system