KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497273
Entry
107497273         CDS       T06036                                 

Gene name
KL
Definition
(RefSeq) klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00040  Pentose and glucuronate interconversions
ray00053  Ascorbate and aldarate metabolism
ray01100  Metabolic pathways
ray04211  Longevity regulating pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04961  Endocrine and other factor-regulated calcium reabsorption
Module
ray_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107497273 (KL)
   00053 Ascorbate and aldarate metabolism
    107497273 (KL)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107497273 (KL)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107497273 (KL)
  09149 Aging
   04211 Longevity regulating pathway
    107497273 (KL)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     107497273 (KL)
Transporters [BR:ray02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   107497273 (KL)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107497273 (KL)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 107497273
NCBI-ProteinID: XP_015974425
LinkDB
Position
Unknown
AA seq 1011 aa
MPAPRRGVARGRAAALLLLLWALGGGRLRAEPGDGAQTWARFARPPAPEAAGLLHDTFPD
GFLWAVGTAAYQTEGGWRQHGKGASIWDAFTHLPAAPPEDPPGAGPPSGFPPRSPPATGD
VASDSYNNVLRDTEGLRELGVTHYRFSISWARVLPNGSAGAPNREGLRYYGHLLQRLREL
GVEPVVTLYHWDLPQRLQDAYGGWADRALVDHFRDYAELCFRHFGGQVKYWITIDNPYAV
AWHGYATGRLAPGVRGGARLAYLVAHNLLLAHAKTWHLYNTSFRATQGGQVSISLSSHWV
NPRRMTNHSIKECQKSLDFVLGWFAKPIFIDGDYPESMKNNLSSLLPTFTESEKKFIKGT
ADFFALSFGPILSFQLLDPRMKFRQLESSSLRQLLSWIDLEYNHPQIFIVENGWFVSETT
KTDDAKYMYYLKRFIMETLKAIRLDGVDVIGYTVWSLMDGFEWHRGYSIRRGLFYVDFLS
QDKKLLPKSSALFYQQLIEKNGFPPLPENQPLEGTFPCAFAWGIVDNYIQVDTTLSQFTD
PSVYLWDVHRSKGLIKVQGLVTQMRKSYCADFAAIRPLVSLLQETHATHFHFSLDWALIL
PLGNRSQVNHTALHFYRCVASELVRANITPVVALWRPAALRPGLPAPLAAHGAWENPHIA
PAFAEYAGLCFKALGSHVKLWVTASEPYTRNLTYRAGHNLLRAHALAWRLYDQQFRRSQG
GRVSIALQADWVEPACPLSPRDKEVAERVLEFDIGWLAEPIFGSGDYPRVMRDWLRQRND
YLLPYFTEDEKRLIRGSFDFLAVSHYTTILVGWEKEDPGKYNDYLEVQEMTDSTWLSSPG
QVAVVPWGLRKVLNWLKLKYGDLPTYIISNGVDDDLHAAQDDVRVYYMQNYVNEALKAYV
LDGIKLCGYFAYSFNDRTAPKFGLYRYAANQFEPKPSMKHYRKIIDDNGFPGPETLGGFC
PEEFTLCANCSFLHTRKSLLAFIAFLCLAFIISLSLIFYYSKKGRRSYKRP
NT seq 3036 nt   +upstreamnt  +downstreamnt
atgcccgcgccgcgccgcggcgtcgcccgcggccgcgccgctgcgctgctgctgctgctg
tgggccctgggcggcggccgcctgcgcgccgagcccggcgacggcgcccagacctgggcc
cgcttcgcgcgacctccggcccccgaggccgcgggcctcctccacgacaccttccccgac
ggcttcctctgggcggtgggcaccgccgcctaccagacggagggcggctggcggcagcac
ggcaagggcgcgtccatctgggacgcgttcacccacctgcccgccgcgccccccgaggac
cccccgggggccggcccgccgtcgggttttccgccgcggtccccgcccgcgactggggac
gtggccagcgacagctacaacaacgtcttgcgcgacacggaggggctgcgcgagctcggg
gtcacccactaccgcttctccatctcgtgggcgcgggtgctccccaatggcagcgcgggc
gcccccaaccgcgaagggctgcgctactacggacacctgctgcagcggctgcgggagctg
ggcgtggagcccgtggtcaccctgtaccactgggacctgccccagcgcctgcaggacgcc
tacggcggctgggccgaccgcgccttggttgaccacttcagggactacgctgagctctgc
ttccgccacttcggcggccaggtcaagtactggatcaccatcgacaacccctacgcggtg
gcctggcacggctacgccaccgggcgcctggcccccggcgtccggggcggcgcgcggctc
gcgtacctggtggcgcacaatctcctcctggctcatgccaaaacctggcatctatacaat
acttctttccgtgcaactcaggggggccaggtgtccatctccctaagttcccactgggtc
aatcctcgaagaatgacaaaccacagcatcaaagaatgtcagaaatctcttgacttcgta
ctaggctggtttgccaaacccatattcattgatggcgactacccagagagcatgaagaat
aatctttcgtctcttctacctacttttaccgaatctgagaaaaagttcatcaagggaaca
gcggacttttttgctctttcctttggcccaatcttgagttttcaactattggaccctcgc
atgaagttccgccaattagaatcttctagcctgaggcaactgctttcctggattgacctg
gaatataaccaccctcaaatatttattgtggaaaatggctggtttgtctcagagaccact
aagacagatgacgctaaatatatgtattacctcaaaagattcataatggaaactttaaaa
gccatcaggctggacggggtggacgtcatcgggtacacagtgtggtccctcatggacggc
tttgagtggcacagaggctatagcatcaggcgcggactcttctacgtggactttctaagc
caggataagaagttgttgccgaagtcttcagccttgttctaccaacagctgatagagaaa
aatggcttccctcctttacctgaaaatcagcccctagaagggacatttccctgtgccttt
gcttgggggattgttgacaactacattcaagtcgacaccactctgtctcagtttaccgac
ccgagcgtctacctgtgggacgtccaccgcagcaaggggctcattaaggtgcagggcctc
gtgacccagatgaggaaatcctactgcgccgacttcgctgccatcaggcctctggtctcc
ctgctccaggaaacgcacgcgacacatttccacttctccctggactgggccctgatcctc
ccgctgggcaaccggtcccaggtgaaccacacggccctgcacttctaccgctgcgtggcc
agcgaactggtgcgcgccaacatcaccccggtggtggccctgtggcgacccgcggccctg
cgcccagggctgcccgcgcccctggcggcgcacggcgcctgggagaacccccacatcgcc
ccggctttcgcggagtacgccgggctgtgctttaaagcgctcggctcgcacgtcaagctc
tgggtgacggcgagcgagccttacacgcggaacctcacctacagggccggccacaacctc
ctgcgggcgcacgcgctggcctggcgcctgtacgaccagcagttccggcgctcgcaggga
gggcgagtctccatcgccctgcaggccgactgggtggaacccgcctgccctctctccccg
agggacaaagaggtggccgagagagttttggaatttgacatcggctggctcgccgagccc
attttcggctctggggattatccacgtgtgatgagggactggctgagacaaagaaacgat
tacctgctgccgtatttcactgaagatgagaaaaggctaatccgaggttcctttgacttt
ctggccgtaagccattacaccaccatccttgtaggctgggagaaagaagatccaggaaaa
tacaatgattacctggaagtgcaagaaatgaccgacagcacctggcttagctcccccggt
caggtggcagtagtgccctggggcctgcgcaaagtcctgaactggctgaagctcaagtac
ggagacctccccacgtacatcatctccaacggcgtggatgacgacctgcacgcagcccag
gacgacgtgagggtgtactacatgcagaattatgtaaatgaagctctgaaagcctatgta
ttggatgggatcaaactttgtggatactttgcatactcgtttaatgatcgcacagctccg
aaatttggcctctatcgttacgctgccaatcagtttgagcccaaaccatccatgaaacat
tacaggaaaattattgacgacaatggcttcccaggtcccgagactctgggagggttttgt
ccagaagaattcaccctgtgtgccaactgcagctttcttcacacgcgaaagtcgttgctg
gccttcatagcttttctctgtttagcttttattatttctctttctcttattttttactac
tctaagaaaggcagaagaagttacaaacggccctga

DBGET integrated database retrieval system