KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499274
Entry
107499274         CDS       T06036                                 

Gene name
GAB1
Definition
(RefSeq) GRB2-associated-binding protein 1 isoform X1
  KO
K09593  GRB2-associated-binding protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04722  Neurotrophin signaling pathway
ray05100  Bacterial invasion of epithelial cells
ray05205  Proteoglycans in cancer
ray05211  Renal cell carcinoma
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107499274 (GAB1)
   04014 Ras signaling pathway
    107499274 (GAB1)
   04072 Phospholipase D signaling pathway
    107499274 (GAB1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107499274 (GAB1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107499274 (GAB1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107499274 (GAB1)
   05226 Gastric cancer
    107499274 (GAB1)
   05211 Renal cell carcinoma
    107499274 (GAB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107499274 (GAB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107499274 (GAB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107499274 (GAB1)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   107499274 (GAB1)
SSDB
Motif
Pfam: PH PH_11 PH_13 PH_9 PH_8 PH_3
Other DBs
NCBI-GeneID: 107499274
NCBI-ProteinID: XP_015978781
LinkDB
Position
Unknown
AA seq 750 aa
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT
EEDPVKPFGNPTPTPADLPVAINTAPASTQADSSSVAPPPPYQLINLPPHLETLGIQEDP
QDYLLLINCQSKKPEPTSQGSSFVSEEGEEYLLLEDFESKTIPLQAHADSTKATSSETDC
NDNVPSHKNPAPSQSKHAVNGFFQQQMMYDSLPTRAASVSVDSSLYNLPRSYSQDVLPKA
SPSGTEADGELYVFNTPSGTSSVETQMRHVSISYDIPPTPSNTYQIPRTFPERTLGQTSK
LDTIPDIPPPRPPKPHPAHDRSPVDTCGITRTASDTDGSYCTPSAGVPPSRSNTISTVDL
NKLRKDASSQDCYDIPRTFPSRCSSLEGFHNHFKIKNVLTVGSVSSEELDENYVPMNPNS
PPRQHSSSFTEPIQEANYVPMTPGTFDFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADC
EPPPVDRNLKPDRKGQSPKILRPKPHGLERTDSQTIGDFATRRKAKPAPLEIKPLPEWEE
LQAPVRSPITRSFARDSSRFPLSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSEDSNLF
GSNSLDGGNSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQ
QKTLALKSTREAWTDGRQSTESETPTKSVK
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgagcggcggcgaagtggtctgctcgggatggctccgaaagtcccccccggagaaaaag
ttgaagcgttatgcatggaagaggagatggttcgtgttacgcagtggccgtttaaccgga
gatccggatgtcttggaatattacaaaaatgatcatgccaagaagcctatccgtattatt
gatttaaatttatgtcagcaagtcgatgctggattgacatttaacaaaaaagagtttgaa
aacagctacatttttgatatcaacaccattgatcgaattttctacctggtagcagacagt
gaggaagagatgaataagtgggttcgctgtatttgtgacatctgtgggtttaatcctaca
gaagaagatcctgtgaagcccttcggcaaccccacaccaacaccagcggatttacctgtc
gccataaacacggcgccagcatccacccaggcggattcgtcatctgtggctccaccgcct
ccatatcagctgatcaaccttccgccacatctggagactcttggcatccaggaggatcct
caagactacctcttgctaatcaactgtcaaagcaagaaacctgaacccaccagccaaggg
tcatcttttgtttctgaagaaggagaggaatacctactactagaagattttgaaagcaaa
acgattccattgcaagcacacgccgattctacaaaagccacctcttctgaaacagactgc
aacgataacgtcccttctcataaaaatcccgctccctcccagagcaaacacgcagtgaac
ggcttcttccagcagcagatgatgtatgactctctgccaactcgcgctgcgtctgtttct
gtagactccagtctttataacctgcccaggagttattcccaggatgttttaccaaaggcg
tctccgtcgggtaccgaagcagatggagaactctacgttttcaataccccatctgggaca
tcgagtgtagagactcagatgaggcatgtatctattagttatgacattcctccaacacct
agtaatacttatcagattccacggacatttcccgaaagaaccttgggacagacgtcaaag
ctagacactattccagatatcccgccaccgcggccaccgaaaccgcatccggctcatgac
cgatctcctgtggacacgtgcggcatcacacgcacggcctcggacaccgacggcagttac
tgcaccccgtccgcgggggtgccgccctcacgcagtaataccatttccactgtggattta
aacaaactgcggaaagatgctagttctcaagactgctatgatattccacgaacatttcca
agtagatgtagttcacttgaaggcttccataaccactttaaaatcaaaaacgtgttgaca
gtaggaagtgtatcgagtgaagaactggatgaaaattacgtcccgatgaatcccaactct
ccgccgcgacaacattccagcagttttacggaaccgattcaggaagccaattacgtgcca
atgaccccagggaccttcgatttctcttcatttggaatgcaggttcctcctcctgctcac
atgggcttcaggtccagcccgaagacccctcccagaaggccagttcctgtcgcagactgt
gagccgcccccggtggataggaacctcaagcccgacagaaaaggtcaaagtcctaaaatt
ttaagacccaaaccccatggtttagagcgaactgattcacaaaccataggtgactttgct
acaagaagaaaggccaagccagcacctttagaaataaaacctttgccagaatgggaagaa
ttacaagccccagttagatctcccatcaccaggagttttgctcgagactcctccaggttc
cccttgtcaccccggccggactcagtgcacagcacgacgtccagcagtgactcgcatgac
agtgaagaaaattacgttcccatgaacccaaacctgtcgagtgaagactcgaatcttttt
ggcagtaacagccttgacggaggaaacagcccgatgatcaagcccaaaggagacaaacaa
gtggaatacctagatctagatttagattctgggaagtccacaccaccacgtaagcaaaag
agcagtggctcaggaagcagtgtggcagatgagagagtggattatgttgtggttgaccaa
cagaagaccctagctctgaagagcacccgggaggcctggacagatgggagacagtccacc
gaatccgaaacaccaaccaagagtgtgaaatga

DBGET integrated database retrieval system