KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507100
Entry
107507100         CDS       T06036                                 

Gene name
SNAP25
Definition
(RefSeq) synaptosomal-associated protein 25 isoform X1
  KO
K18211  synaptosomal-associated protein 25
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04721  Synaptic vesicle cycle
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107507100 (SNAP25)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    107507100 (SNAP25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107507100 (SNAP25)
Membrane trafficking [BR:ray04131]
 SNARE
  SNAP-25 (Qb,c)
   SNAP-25
    107507100 (SNAP25)
SSDB
Motif
Pfam: SNAP-25 DUF5089 Spc7 Sec20 V-SNARE_C DUF349
Other DBs
NCBI-GeneID: 107507100
NCBI-ProteinID: XP_015993584
LinkDB
Position
Unknown
AA seq 206 aa
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERI
EEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARV
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR
IMEKADSNKTRIDEANQRATKMLGSG
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgaagacgcggacatgcgcaatgagctggaagagatgcagcgaagggctgaccag
ctggctgatgagtcactggaaagcacccgtcgtatgctgcaactggttgaagagagtaaa
gatgctggtatcaggactttggttatgttggatgaacaaggagaacaactggaacgcatt
gaggaagggatggaccaaatcaataaggacatgaaagaagcagaaaagaatttgacggac
ctaggaaaattctgcgggctttgtgtgtgtccctgtaacaagcttaaatcaagtgatgct
tacaaaaaagcttggggcaataatcaggatggagtagtggccagccagcctgcccgtgtg
gtggacgaacgggagcagatggccatcagtggtggcttcatccgcagggtaacaaatgat
gcccgagaaaatgaaatggatgaaaacctggagcaggtgagcggcatcattggaaacctc
cgtcacatggcccttgatatgggcaatgagatcgatacacagaatcgccagattgacagg
atcatggagaaggctgattccaacaaaaccagaattgatgaggccaaccaacgcgcaaca
aagatgctggggagtggttaa

DBGET integrated database retrieval system