KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509571
Entry
107509571         CDS       T06036                                 

Gene name
PRKCE
Definition
(RefSeq) protein kinase C epsilon type isoform X1
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04071  Sphingolipid signaling pathway
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04530  Tight junction
ray04666  Fc gamma R-mediated phagocytosis
ray04750  Inflammatory mediator regulation of TRP channels
ray04925  Aldosterone synthesis and secretion
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107509571 (PRKCE)
   04071 Sphingolipid signaling pathway
    107509571 (PRKCE)
   04022 cGMP-PKG signaling pathway
    107509571 (PRKCE)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107509571 (PRKCE)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107509571 (PRKCE)
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107509571 (PRKCE)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107509571 (PRKCE)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107509571 (PRKCE)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107509571 (PRKCE)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107509571 (PRKCE)
   04931 Insulin resistance
    107509571 (PRKCE)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107509571 (PRKCE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107509571 (PRKCE)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107509571 (PRKCE)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107509571 (PRKCE)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C FTA2 Kinase-like Kdo PP_M1
Other DBs
NCBI-GeneID: 107509571
NCBI-ProteinID: XP_015997697
LinkDB
Position
Unknown
AA seq 737 aa
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGKVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDEVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLVAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSMDGQLASPGENGEVRQGQAKRLGLEEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPNKRLGCVAAQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP
NT seq 2214 nt   +upstreamnt  +downstreamnt
atggtagtgttcaatggccttcttaagatcaaaatctgcgaggccgtgagcttgaagccc
acagcctggtcgctgcgccatgcagtgggaccccggccacagactttccttctcgacccc
tacatcgccctcaacgtggacgattcgcgcatcggccaaaccgccaccaagcagaagacc
aacagcccggcctggcacgatgagttcgttactgatgtgtgcaacgggcgcaaaatcgag
ctggccgtcttccacgatgcccccatcggctacgatgacttcgtggccaactgcaccatc
caatttgaggagctgctgcagaacgggagtcgccacttcgaggactggattgatctggag
ccagaaggcaaagtgtatgtgatcatcgatctttccgggtcatcaggtgaagcccctaaa
gacaatgaagagcgtgtgttcagggagcgcatgcggcccaggaagaggcagggggccgtc
aggcgcagggtccaccaggtcaatggccacaagttcatggccacctaccttcggcagccc
acctactgctcccactgcagagattttatctggggtgtcataggaaagcagggataccaa
tgtcaagtttgcacttgcgtggtccacaagcgatgccatgagctcataattacgaagtgt
gccggattaaagaaacaggaaactcctgacgaggtgggctcccagcggttcagcgtcaac
atgccccacaagttcggtatccacaactacaaggtccccaccttctgtgaccactgcggg
tccctgctctggggcctcttgcggcagggtttgcagtgtaaagtctgcaagatgaacgtt
caccgacgctgtgagaccaatgtggctcccaactgcggagtggatgccagaggtattgcc
aaggtgctggctgacctcggcgtcactccagacaaaatcaccaacagcggccagaggagg
aaaaagctcgtggctggtgctgagtccccacagcctgcttctggaagctcaccctctgag
gaggatcggtccaagtcagcacccacctccccttgtgaccaggaaattaaagaacttgaa
aacaacatccggaaggccttgtcatttgacaaccgaggtgaggagcacagggcagcatca
tccatggatggccagctggcaagccctggtgagaacggcgaagtccggcaaggccaggcc
aagcgcttgggcttggaggagttcaacttcatcaaagtgttgggcaaaggcagctttggc
aaggtcatgttggcagagctcaaaggcaaagatgaagtgtatgctgtgaaagtcttaaag
aaggatgtcatccttcaggatgatgatgtggactgcacaatgacagagaagaggattttg
gctctggcgcggaaacacccatacctaacccagctctattgctgcttccagaccaaggac
cgtctctttttcgtcatggagtatgtaaatggcggagacctcatgttccagattcagcgc
tcccgaaaattcgatgagcctcgttcccggttctatgctgcagaggtcacgtcagccctc
atgttcctccatcaacatggagtcatctacagggatttgaaactggacaacatccttctg
gatgcagaaggtcactgcaagctggccgactttgggatgtgcaaggaagggattctgaac
ggtgtgacgaccaccacattctgtgggactcctgactacattgctcctgagatcctgcaa
gagttggagtacggcccctcggtggactggtgggccctgggggttctgatgtatgagatg
atggctgggcagccccccttcgaggctgacaacgaggatgacctgtttgagtccatcctc
catgatgatgtgctctacccagtctggctcagtaaggaggccgtcagcatcctgaaagct
ttcatgactaagaaccccaacaagcgcctgggctgtgtggcggcacagaatggcgaggac
gccatcaagcagcacccgttcttcaaggagattgactgggtgctcctggagcagaagaag
atcaagccgcccttcaaacctcgaattaaaaccaaaagagatgtcaataactttgaccaa
gactttacccgggaagagccggtactcacgcttgtggatgaagcgattgtgaagcagatc
aaccaagaggaattcaaaggcttctcctactttggtgaagacctgatgccctga

DBGET integrated database retrieval system