KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509837
Entry
107509837         CDS       T06036                                 

Gene name
KRT18
Definition
(RefSeq) keratin, type I cytoskeletal 18
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107509837 (KRT18)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107509837 (KRT18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107509837 (KRT18)
   04147 Exosome [BR:ray04147]
    107509837 (KRT18)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107509837 (KRT18)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107509837 (KRT18)
  Exosomal proteins of other body fluids (saliva and urine)
   107509837 (KRT18)
  Exosomal proteins of colorectal cancer cells
   107509837 (KRT18)
  Exosomal proteins of melanoma cells
   107509837 (KRT18)
SSDB
Motif
Pfam: Filament Spc7 TPR_MLP1_2 Nsp1_C T2SSM_b
Other DBs
NCBI-GeneID: 107509837
NCBI-ProteinID: XP_015998165
LinkDB
Position
Unknown
AA seq 428 aa
MSFSTRSSFSSYRTLGSVQTPSHRVRPASSAASVYAGAGGSGSRISVSHSTSVRGGWGSG
GLAAGMAGGLAGIGGIQTEKETMQSLNDRLASYLERVRSLEADNRRLESKIREHLEKKGP
QVRDWGHYFKTIEDLRAQIFASSVDNARIVLQIDNARLAADDFRVKYETELAMRQSVESD
INGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVNGLQNQIANSGLTVELDAPK
SQDLSKIMADIRVRYDELARKNREELDKYWSQQIEESTTVVTSQTAEIGAAEMTLTELRR
TVQSLEIDLNSMKNLKASLENSLTEVEARYAMQMEQLNGILLHLESELAQTRAEGQRQAQ
EYEALLNIKVKLEAEIATYRRLLEEGEDFDLSDALDSNSMQSIQKTTTRKIVDGKVVSEV
NDTKILRR
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgagcttcagcacccgctccagcttctccagctaccggaccctgggctccgtgcagacg
cccagccaccgggtccggccggccagcagcgccgccagcgtgtatgcaggtgcagggggc
tcaggctcccggatctctgtatcccactccaccagcgtccgcggtggttggggatccggg
ggcctggccgcggggatggccgggggcctagcgggcatagggggcatccagactgagaag
gagactatgcaatccctgaatgaccgcctggcctcttacctggagagggtgaggagcctg
gaggctgataataggagactggagagcaaaatccgggaacacctggagaagaagggaccc
caggtcagagactggggacattactttaagaccatcgaggacctgagggctcagatcttt
gcaagttctgtggacaatgcccgcatcgttctacagattgacaatgcccgccttgctgct
gatgacttcagagtcaagtatgagacagagctggccatgcgccagtctgtggagagtgac
atcaatggactccgaaaggtcattgatgacaccaatatcactcggctgcagctggagaca
gagatcgaggctctcaaggaggagctgcttttcatgaagaagaaccatgaggaggaagta
aatggtctacaaaaccagattgccaactctgggttgactgtggagttggatgcccccaaa
tctcaagacctcagcaagatcatggcggacatccgggtccggtatgacgaactggctcgg
aagaacagagaagagctagacaagtactggtcccaacagattgaggagagcaccacagta
gtcacctcgcagaccgctgagataggagctgccgagatgacactcacggagctgagacgt
acagtccaatctttggaaatcgacctgaattcgatgaaaaatttgaaggccagcttggaa
aacagcctgacagaagtggaggcacgctatgccatgcagatggaacagctcaacgggatc
ctgttgcacctggagtcagagctggcccagacccgggcagaggggcagcgccaggcccag
gagtatgaggccctgctgaacatcaaagtcaagctggaggctgagattgccacctaccgc
cgcctgctggaagagggggaggatttcgatcttagtgacgccctggacagcaactccatg
caatccatacaaaagaccaccactcgcaagattgtggatggcaaagttgtgtctgaggtc
aatgacaccaaaattctgaggcgttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513759
Entry
107513759         CDS       T06036                                 

Definition
(RefSeq) keratin, type I cuticular Ha7-like
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513759
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513759
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513759
   04147 Exosome [BR:ray04147]
    107513759
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513759
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513759
  Exosomal proteins of other body fluids (saliva and urine)
   107513759
  Exosomal proteins of colorectal cancer cells
   107513759
  Exosomal proteins of melanoma cells
   107513759
SSDB
Motif
Pfam: Filament DUF5082 AAA_assoc
Other DBs
NCBI-GeneID: 107513759
NCBI-ProteinID: XP_016006263
LinkDB
Position
Unknown
AA seq 437 aa
MTSDGCSSLLTGRVSEARATSPGLSATMAHTNRVRVGMTPLGRPSLCLPPSCNTACPLPG
TCHVPGNIGNCGAYGEGSLNGHEKVTMQFLNDRLANYLEKVRQLERDNAELETKIREWSK
CHESTVCPDYQSYFRSIEELQQKILRIKSEKNSLVVQMDNAKLAADDFRTKYQTEHSLCQ
LVEADVCGLRRVLDDLTLAKCDLEAQVESLKEELLCLKKNHEQEFHTLQCQLGDRLRIEL
DAEPTVDLSRVLEAMRCQYEAMVETNRRDVEQWFQAQSEGISLQATSCSEELQCCQSEIL
ELRRTVNALEVELQAQHTLKDCLQNSLCESEARYGTELAQMQSLISTVESQLSEIRADLE
RQNQEYQVLLDMQAQLEGEISTYRKLLESEDCKLPCNSCVTLASSTLRPAPTACTSCSSC
LSRPPQAACEPCSSPQC
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgacttctgatggctgcagttctctcctcaccggccgggtatcagaggccagggctacc
tccccgggcctctcggccaccatggcacacaccaatagagtccgtgtggggatgaccccc
ctgggccgacccagcctctgtctgccccccagctgcaacaccgcgtgccccttgccaggg
acctgccacgttcccggcaacattggaaattgtggggcctacggtgaaggcagcctgaac
ggccacgagaaggtgaccatgcagttcctgaacgaccggctggccaactacctggagaag
gtgcgccagctggagcgggacaacgcggagctggagaccaagatccgagagtggagcaaa
tgccacgagtccactgtgtgcccagactaccagagctacttccggagcatcgaggagctc
cagcagaagattctgcgcatcaaatcagagaaaaacagcctggttgtgcaaatggacaat
gccaaactggctgcagatgacttcaggaccaaataccagacagagcactcgctttgccag
ctggtggaggccgacgtctgcggcctccgcagggtgctggatgacctcacacttgccaag
tgcgacctggaggcccaggtggagtctctgaaggaggagctgctgtgccttaagaagaac
cacgagcaggaattccacactctgcagtgccagctgggggacaggctccggatcgagctg
gacgctgagcccaccgtggacctgagcagggtgctggaggcgatgcggtgccagtacgag
gccatggtggagaccaaccggcgcgatgtggagcagtggttccaagctcagtccgagggc
atcagcctgcaggccacgtcctgctccgaggagctgcagtgctgccagtcggagatcctg
gagctgagacgcacggtgaacgccctggaggtggagcttcaggctcagcacacactgaag
gactgcctgcagaactccctgtgtgagtctgaggcccgctatggcaccgagctagcccag
atgcagagcctgatcagcaccgtggagtcccagctgtcagagatccgggccgacctggag
cggcagaaccaggagtaccaggtgctgctggacatgcaggcccagctggagggcgagatc
agcacgtaccggaaacttctagagagcgaggactgcaagcttccctgcaactcatgtgtg
accctagcctccagcaccctcagaccagcccctacagcctgtacctcctgctcttcctgc
ctttccaggcctcctcaggctgcctgtgagccctgctcatcacctcagtgctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513760
Entry
107513760         CDS       T06036                                 

Definition
(RefSeq) keratin, type I cytoskeletal 42
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513760
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513760
   04147 Exosome [BR:ray04147]
    107513760
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513760
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513760
  Exosomal proteins of other body fluids (saliva and urine)
   107513760
  Exosomal proteins of colorectal cancer cells
   107513760
  Exosomal proteins of melanoma cells
   107513760
SSDB
Motif
Pfam: Filament DUF1664 TPR_MLP1_2 DUF4407 SDH_beta Atg14 Tweety Bacillus_HBL
Other DBs
NCBI-GeneID: 107513760
NCBI-ProteinID: XP_016006265
LinkDB
Position
Unknown
AA seq 451 aa
MAATTTSIRQFSTSGSVKGLGMPSGGLSRVSTVRVGSSCRAPSLLGSGSCGNMSVTSSRF
SAGLGGGYSGGYTCNLGGGFGPSFGVSDALLGGGEKETMQNLNDRLASYLEKVRALEEAN
ADLEVKIRDWYKKQGPEPTRDYSHYFKTIEELRNKILAATVDNARLVLQIDNARLAADDF
RTKYETELNLRMSVEADTNGLRRVLDELTLARADLEMQIENLKEELAYLRKNHEEEMNAL
RGQVGGDVSVEMDAAPGVDLSRILNEMRDQYEKIAEKNRKDAEDWFFSKTEELNREVATN
TEALQSSRTEITELRRSVQNLEIELQSQLSMKASLEGSLAETEARYGVQLAQLQGLISSI
EQQLGELRCDMERQNHEYQVLLDVKTRLEQEIATYRRLLEGEDAHLATQYSLSLASQPTR
EVTSRQVRTIVEEVQDGKVVSSREQVHRSTH
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggctgccaccaccaccagcatccgccagttctcaacctctggctctgtcaagggcctg
ggcatgcccagcgggggtttgtctcgggtgtccacagtccgtgttgggagctcctgcaga
gcccccagcctcctggggtctggcagctgtggcaatatgtcagtcacctcatcccgcttc
tcggcgggcttggggggcggctatagcggcggctacacttgcaacctgggtgggggcttc
ggccccagcttcggtgtatcggatgctttgctgggcggcggcgagaaggagaccatgcag
aacctcaacgaccgcctggcctcctacctggagaaggtgcgcgccctggaggaggccaac
gccgacctggaggtgaagatccgtgactggtataagaagcagggccctgagcccacccgt
gactacagccattatttcaagaccatcgaggagctgaggaacaagatcctggcggccacc
gtggacaacgcgcgcttggtgctgcagatagacaatgcccgcctggcggccgacgacttc
cgcaccaagtatgagacggagctgaacctgcgcatgagcgtggaggccgacaccaacggc
ctgcgcagggtgctggacgagctgaccctggccagagccgacctggagatgcagatcgag
aatctgaaggaggagctggcctacctgaggaagaaccacgaggaggaaatgaacgccttg
cgaggccaggtgggcggggacgtcagcgtggagatggacgccgcccccggcgtggacctg
agccgcatcctgaacgagatgcgcgaccagtacgagaagatagcggagaagaaccgcaag
gacgccgaggactggttcttcagcaagacggaggagctgaaccgtgaggtggccaccaac
accgaggccctgcagagcagcaggacggagatcacggagcttcgccgctctgtgcagaac
ctggagattgagctgcagtcccagctcagcatgaaagcatccctggagggcagcctggcg
gagaccgaggcccgctacggggttcagctggctcagctgcaggggctcatcagcagcatc
gagcagcagctgggtgagctccgctgcgacatggagcgtcagaaccatgagtatcaggtg
ctactggacgtgaagacgaggctggagcaggagatcgctacctaccgccgcctgctggag
ggcgaggacgcccacctggctacccagtactccttgtccctggcctcgcagcccaccagg
gaagtgaccagccgccaggtgcgcaccatcgtggaggaggtccaagacggcaaggtggtt
tcttctcgagagcaagtccatcgctccacccactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513768
Entry
107513768         CDS       T06036                                 

Gene name
KRT23
Definition
(RefSeq) keratin, type I cytoskeletal 23
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513768 (KRT23)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513768 (KRT23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513768 (KRT23)
   04147 Exosome [BR:ray04147]
    107513768 (KRT23)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513768 (KRT23)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513768 (KRT23)
  Exosomal proteins of other body fluids (saliva and urine)
   107513768 (KRT23)
  Exosomal proteins of colorectal cancer cells
   107513768 (KRT23)
  Exosomal proteins of melanoma cells
   107513768 (KRT23)
SSDB
Motif
Pfam: Filament CENP-F_leu_zip
Other DBs
NCBI-GeneID: 107513768
NCBI-ProteinID: XP_016006279
LinkDB
Position
Unknown
AA seq 425 aa
MTSWGSFGQSPSGSPHGTGGGWVRPGRFPRAPSVHGGAGGVRISLSPSCLAPGGSWGPGR
GSSLVGGNGKMMMQNLNDRLASYLDKVRALEEANVKLESRIRKWHQQKDPGSKHDYSQHE
ENISSLQEQIVDGKLTNAQIILLIDNARMAVDDFSLKYENEHSLKKDLEIEVEALRKTLD
DLTIITTDLEQEVEGMRKELILMKKRHEKEMEERHVPNDCMVNVKVDTTPGEDLIKVLED
MRQEYEFMIKKKHQDLDAWYKEQSAAMAQEAAMAQEAASPTALQSGQSNIHELKRTFQAL
EIDLQAQCNRKSALENMLSETQSRYSCQLRDMQRILSHYEEELMQLRHDLERQNREYKVL
LGIKTHLEKEIATYRQLLDGENEGTMEESKLSIKASAAPKIKAITQESINGRIIYSQVKE
IQKYA
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgacctcctggggcagcttcggccagagcccctctggctcccctcatggcacaggaggc
ggctgggttcggcccgggaggttcccccgggctcccagcgtccatgggggcgcagggggt
gtccgcatctccctctcaccaagctgcctggcacctggagggtcttggggacctggaaga
ggcagttccctcgtaggtggaaatgggaagatgatgatgcagaacctcaatgaccgcctg
gcctcctacctggacaaggtgcgcgcactggaggaggccaacgtgaagctcgaaagtcgc
atccggaagtggcatcagcagaaagatcctggcagcaagcacgattactcccaacacgaa
gaaaacatcagtagcctgcaggagcagatagtggatggtaagctgacaaatgcccagatc
attcttctcattgacaacgcaaggatggcagtggatgacttcagcctcaagtatgaaaat
gaacactccctcaagaaagacttggaaattgaagttgaggctctccgaaagaccttggat
gacctaaccattatcacaacagacctggagcaggaggtagaggggatgaggaaagagctc
atcctcatgaagaagcgccatgagaaggaaatggaggaacgccatgtgccaaatgactgc
atggtcaatgtgaaggtggatacaaccccaggggaagatctgattaaggtcctggaggat
atgaggcaggaatacgagtttatgataaagaagaagcaccaagatttggatgcttggtat
aaagagcagtcagcagccatggcccaggaggcagccatggcccaggaagcggccagtcca
acagctctgcagagcggccaaagtaatatccatgagttgaagcgtactttccaggccctg
gagattgacctacaggctcagtgcaacaggaaatccgctttagaaaacatgttatccgag
acccagtctcggtactcctgccagctccgggacatgcaacggatcctctcccactacgag
gaggaactgatgcagctccgccatgacctggagcgtcagaaccgcgaatacaaggtcctt
ctgggcatcaaaacccacctagagaaggaaatcgccacctaccgccagctcctggatggg
gagaacgaagggacaatggaggaatctaagctgagtataaaagcgtctgcagctccaaag
atcaaggccatcacacaggagagcatcaatggaagaataatttattctcaagtgaaagag
atccaaaagtatgcgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513769
Entry
107513769         CDS       T06036                                 

Gene name
KRT28
Definition
(RefSeq) keratin, type I cytoskeletal 28
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513769 (KRT28)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513769 (KRT28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513769 (KRT28)
   04147 Exosome [BR:ray04147]
    107513769 (KRT28)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513769 (KRT28)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513769 (KRT28)
  Exosomal proteins of other body fluids (saliva and urine)
   107513769 (KRT28)
  Exosomal proteins of colorectal cancer cells
   107513769 (KRT28)
  Exosomal proteins of melanoma cells
   107513769 (KRT28)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 HrpA_pilin Bacillus_HBL
Other DBs
NCBI-GeneID: 107513769
NCBI-ProteinID: XP_016006280
LinkDB
Position
Unknown
AA seq 463 aa
MSLRFSSGSRRIYLRSGAGSVRPSNGGTGFAGSSACGSSVAGSGFSCALGGGLGSAPGGN
HAGGALGGACAGFAGSEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANAELERKIKGW
YEKYGPGSCRGLDHDYSRYHLTIEDLKNKIISSTTANANVILQIDNARLAADDFRLKYES
ELALHQNTEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLRKNHEEEMKALQCAAGG
NVNVEMNAAPGVDLTVLLNNMRAEYEDLAEQNRRDAEAWFHEKSATLQQQISDDAGAATS
ARTELTEMKRTLQTQEIELQSLLAMKHSLECSLSETEGNYCVQLAQIQAQIGALEEQLHQ
VRTETEGQKLEYEQLLDIKVHLEKEIETYCRLIDGDGNSCSKSKGFGSGSSVNLSRDLSK
TTLVKTVVEELDQRGKVLSSRIHSIEEKTSKMTNGKTEQRVSF
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtctctccggttttctagtgggtccaggcgtatttacttacggtctggagctgggtct
gtcagaccatccaatggaggtacaggctttgcaggcagcagtgcgtgtggcagctccgtc
gctggaagcggattttcctgtgccttgggaggaggcttgggcagtgctcctggtgggaac
catgctggtggtgctcttggtggtgcttgtgccggctttgctggaagcgaagggggactc
ctctctgggaatgagaaggtgaccatgcagaatcttaatgaccgcttggcatcctatctg
gataacgtacgtgctctggaggaggccaacgctgaactagagagaaaaatcaagggttgg
tatgaaaaatacggtcctggatcttgtcgtggacttgatcatgactacagcagatatcac
ctaacaatcgaagatctcaagaataagataatctcttccactactgctaacgctaatgtc
attctgcagattgataatgctagactggctgctgatgatttccggctaaagtatgaaagt
gagctcgccctccaccaaaacacagaggctgacatcaatgggctgcggcgcgtcctggat
gaactgacactctgcaggaccgatcaggagctacagtatgaatccctgagtgaagagatg
acgtatctcaggaaaaaccatgaagaggaaatgaaggctctgcagtgcgctgctgggggc
aacgtaaacgtggagatgaacgcggcgcctggcgtggacctcacggttctgctgaacaac
atgcgggctgagtacgaggacctcgccgagcagaaccgccgggatgcagaagcctggttc
cacgagaagagtgccactctgcagcagcagatctccgacgacgctggcgcagccacctcg
gccaggacggagctgacagaaatgaaacgcaccctgcagacccaggagattgagctccag
tctctcctggcgatgaaacactccctggagtgctccttgtcagagacagaaggcaactac
tgtgtgcagctggcccagatccaggctcagatcggggccctggaggagcagctgcaccag
gtccgaaccgagactgagggccagaagctggagtacgagcagctcctggacatcaaggtc
cacctggaaaaggaaatcgagacctactgccgcctgatagatggagatggaaactcatgc
tctaaatcaaagggctttggatcaggaagctcagtgaatttatctagagatttatccaaa
actacactggtaaagacggtggttgaagagctagatcaacgtggtaaagtcctttcatcg
aggattcactccattgaagaaaaaacatctaaaatgaccaatgggaagacagaacaaagg
gtttctttctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513770
Entry
107513770         CDS       T06036                                 

Gene name
KRT10
Definition
(RefSeq) LOW QUALITY PROTEIN: keratin, type I cytoskeletal 10
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513770 (KRT10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513770 (KRT10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513770 (KRT10)
   04147 Exosome [BR:ray04147]
    107513770 (KRT10)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513770 (KRT10)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513770 (KRT10)
  Exosomal proteins of other body fluids (saliva and urine)
   107513770 (KRT10)
  Exosomal proteins of colorectal cancer cells
   107513770 (KRT10)
  Exosomal proteins of melanoma cells
   107513770 (KRT10)
SSDB
Motif
Pfam: Filament Spc7 APG6_N TPR_MLP1_2 Fez1 Jnk-SapK_ap_N DUF724 FlxA DUF4407
Other DBs
NCBI-GeneID: 107513770
NCBI-ProteinID: XP_016006281
LinkDB
Position
Unknown
AA seq 599 aa
MSVQYGSSKHYSSSRSGGGGRGSSLRVSSTKCSIGGGFSSGGGFSGGSFSRGSSGGGCFG
GSSGGYGGGLGGGLGGGFGGGSFSGGYASSSFGGGYGGGGYGGGGFGGGSFGGGSFGGGG
LGGFGGGYGGDGGGLLNGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKQWYEKYG
SNNQREPRDYSKYYKTIDDLKNQILNLTTDNANALLQIDNARLAADDFRLKYENEVALRQ
SVDADINGLRRVLDELTLAKADLEMQIESLTEELAYLRKNHDEEMKDFQNVNTGDVNVEM
NAAPGVDLTQLLNNMRNQYEELAEQNRKDAEAWYNEKSKELTTEIDNNIEQISSYKNEIT
ELRRTIQGLEIELQSQLALKQSGEASLAETEGRYCAQLAQIQGQISTLEEQLQQIRAETE
CQNSEYQQLLDIKIRLENEIQTYRSLLEGEGGSGGGSYRGGRGGGSSGGGGGGYGGSSSG
GYGGSSGGGGGGYGGSSSGGGGGGGYGGSSSGGGGGGSGSYGGSSXGGGGGGYGGGSSGG
GHKSSSGSAGESSSKGPRSAETSWDTNKARVIKTIIEEVAPDGRVLSSMVESETKKHYY
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgtctgttcaatacggctcaagcaagcattactcttcctcccgcagtggaggaggtgga
agaggatcatccctccgagtttcaagcaccaaatgctccattggtggaggatttagctca
gggggtggtttcagtggtggctcttttagccgagggagctctggtggtggctgctttggg
ggctcatcaggtggctatggaggaggtttaggaggaggattaggaggaggttttggtgga
ggtagctttagtggaggctatgcaagcagcagctttggtgggggctatggaggaggcggc
tatggaggaggcggctttggaggaggcagcttcggtgggggaagctttggtggaggtggc
cttggaggctttggtggtggatatggaggagatggtggtggccttctcaacggaaatgaa
aaagtaaccatgcagaatctgaatgaccgcctggcttcctacttggacaaagttcgagct
ctggaagaatcaaactatgagctagaaggcaaaattaagcagtggtatgaaaagtatggc
agcaacaaccagcgagagcctcgtgactacagcaagtactataaaaccatcgatgatctt
aaaaatcagatccttaatctaacaaccgataacgccaatgccctgcttcagatcgacaat
gccaggctggcagctgacgacttcaggctgaagtatgagaatgaagtagccctgcgccag
agcgtggatgctgacatcaacggcctgcgtagggtgctggatgaactgaccctggccaag
gctgacctggagatgcagatcgaaagcctgactgaagagctggcctacctgaggaagaat
cacgacgaggaaatgaaagacttccaaaatgtgaacactggtgatgtgaatgtggaaatg
aatgctgccccaggcgttgatctgactcaacttctgaataacatgagaaaccagtatgaa
gaacttgctgaacaaaaccgcaaagatgctgaagcctggtacaatgaaaagagtaaggaa
ctgactacggaaatcgataataacattgaacaaatatccagctataaaaatgagattact
gaattgagacgcacaattcaaggtctggagatcgaactacagtcccaactagcactgaaa
caatccggggaagcctccttggcagaaacagaaggtcgctactgtgcgcagctcgcacag
attcagggccagatctccaccctggaggaacaactgcaacagattcgagctgaaaccgag
tgccagaattctgagtaccaacaactcctggatattaagatccgactggagaatgaaatt
caaacctaccgcagcctgctagaaggagagggaggttccggcggaggctcctaccgcggc
gggcgcggcggcggaagttccggcggcggcggcggcggctacggcggcagctccagcggc
ggctacggcggcagttccggcggcggcggcggcggctacggtggcagttccagcggcggc
ggcggcggcggcggctacggtggcagttccagcggcggcggcggcggcggcagcggcagt
tacggcggcagttccnggggcggcggcggcggcggctacggcggcggcagctcgggcgga
ggccacaagtcctcttccgggtccgctggagagtcttcatctaagggaccaaggtcagct
gaaactagctgggatactaacaaagccagagtaatcaagacaattattgaagaagtggca
cccgatggtagagtcctttcatctatggttgaatcagaaaccaagaaacactactattaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513771
Entry
107513771         CDS       T06036                                 

Gene name
KRT12
Definition
(RefSeq) keratin, type I cytoskeletal 12
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513771 (KRT12)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513771 (KRT12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513771 (KRT12)
   04147 Exosome [BR:ray04147]
    107513771 (KRT12)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513771 (KRT12)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513771 (KRT12)
  Exosomal proteins of other body fluids (saliva and urine)
   107513771 (KRT12)
  Exosomal proteins of colorectal cancer cells
   107513771 (KRT12)
  Exosomal proteins of melanoma cells
   107513771 (KRT12)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Jnk-SapK_ap_N SPATA1_C DUF2944 T2SSM
Other DBs
NCBI-GeneID: 107513771
NCBI-ProteinID: XP_016006282
LinkDB
Position
Unknown
AA seq 488 aa
MSLSVQTSGLSRRSSSQSGALGRARGMSASSAGSGYGGSILGFGGGYGGGFSGASMFGSG
SGLSGGSGSFLAGGLGAAYGGALGGGFGGLGIGLGGSPGGGSPGILSGNDGGLLYGSEKE
TMQNLNDRLASYLDKVRALEEANTELENKIREWYETQGSGTEDPGSQSDYSKYYPLIEDL
RNKIISASIGNAQLILQIDNARLAAEDFRMKYENELALRQSVEADINGLRRVLDELTLAR
ADLEMQIESLNEELVYLRKNHEEELQSFRTDGPGQLTVEMDAAPGVDLTRLLNDMRSQYE
AIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMK
KSLEDSLAQTEGEYCGQLSQVQQLIGSLEEQLLQLRADTERQNADHQRLLNVKARLELEI
ETYRRLLDGEAQGDGLDESSSETDSKSQAQSIDSSKDPTKSRKIKAIIQKVVNDEVVSTQ
VQELEQLI
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgtcactctcggtgcagacttctgggctgtccagacggtcgtcttctcagagtggggca
ctgggcagagccaggggcatgtctgcttccagcgctggcagtggctatgggggaagcatc
cttggctttggaggcggctatggaggaggcttttctggtgcttccatgtttggttctggt
tctggcctaagtggtggctctggaagtttccttgcaggaggactgggtgctgcttatggg
ggagctctgggaggtggctttggaggcctggggattggactagggggaagcccgggaggt
ggctctccaggtattctctctggcaatgatggaggccttctttacggatcagaaaaggaa
accatgcaaaatctcaatgacagattggcttcctacttggataaggttcgagctctagaa
gaggcaaatactgagctggaaaacaaaattcgagaatggtacgaaacacaaggatctggg
accgaagaccccgggtcacagagtgattacagtaaatattatcccttgattgaagatctc
aggaataagatcatttctgccagcattggaaacgcccagctcatcttgcagatcgacaat
gcaagactggctgccgaagacttcaggatgaagtatgagaacgagctggccctgcgccag
agtgtggaggccgacatcaacggcctgcgcagggtgctggacgagctgaccctggccaga
gctgacctggagatgcagattgagagcctgaatgaggagctggtctacctgaggaagaac
cacgaggaggagctccaaagcttccggacggacggcccaggccagctcactgtagaaatg
gatgctgctcccggggtggacctcaccaggctcctcaacgacatgaggtcgcagtatgaa
gccattgccgagcagaaccgtaaggatgcggaagcctggtttattgaaaagagcggggag
ctcaggaaggagatcagcaccaacaccgagcagcttcagtccagcaagagcgaggtcacc
gacctgaggcgcgcctttcaaaatctggagatcgagctccagtcccagctcgccatgaag
aaatccttggaggactcgttggcccaaaccgaaggcgagtactgcggccagttgtcccag
gtgcagcagctcatcggcagcctggaggagcagctgctccagctgcgcgccgacactgag
cgccagaacgcggaccaccagcggctgctgaacgtcaaggcccgcctggagctggagatc
gagacctaccgccgcctgctggacggcgaggcccaaggtgatggtttggatgaaagttca
tctgaaacagactccaaatctcaagcacagtccattgattcctctaaagacccaaccaaa
agccgaaaaatcaaggcaatcatccagaaagtggtgaatgatgaagtggtctcaacccaa
gttcaggaacttgaacaactaatataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513772
Entry
107513772         CDS       T06036                                 

Definition
(RefSeq) keratin, type I cytoskeletal 40-like
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513772
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513772
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513772
   04147 Exosome [BR:ray04147]
    107513772
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513772
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513772
  Exosomal proteins of other body fluids (saliva and urine)
   107513772
  Exosomal proteins of colorectal cancer cells
   107513772
  Exosomal proteins of melanoma cells
   107513772
SSDB
Motif
Pfam: Filament TPR_MLP1_2 UPF0184 UPF0242 Baculo_PEP_C
Other DBs
NCBI-GeneID: 107513772
NCBI-ProteinID: XP_016006283
LinkDB
Position
Unknown
AA seq 459 aa
MTSDYLLTCSSSESYAGAPNGATVSTCSMETTCLPSTCATPRCQTPSFLPRSCLPAGCLA
PCYLAGSCNVPCVVGNSAWCEDGMFNSNEKETMQFLNDRLASYLEKVRALEEMNAELECR
IREQCEGDIPLVCPDYQCYFDTIEDLQQKILCTKAENSRLAVQLDNCKLAADDFRSKYES
ELSLHQLVETDIGSLRGILGELTLCKANLEAHVESLKEDLLCLKKNHKEEVNLLHGQLGD
RLTVELNSDPTMDLNSVLDEMRCQYETVLANNRRDAEEWFTIQVSTWRDTTTGFQASALF
AFSNLIVPVFQTQELNQQQLSSAEQLQGCQTEILELKRTANALEIELQAQQSLTESLECT
VAETEAQYSTQLAQIQCLIDNVENQLAEIRCDLERQNQEYEVLLDTKARLEGEINTYRGL
LESEDSRLPCNPCSTTSTSSNTCEPCSAYVLCTVENCCV
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacttctgactatttgctcacatgcagctcgtctgagtcttatgccggggctcctaat
ggcgccactgtttctacctgttctatggaaaccacttgtcttcccagcacctgtgctaca
cccagatgccagactccgagcttcctacccaggtcttgcttgccagcgggttgcctcgca
ccatgctacctcgctgggagttgtaatgttccgtgcgtggtggggaactctgcttggtgt
gaggatgggatgttcaacagcaatgagaaggagacaatgcagttcctgaatgacagactc
gccagctatctggagaaggtgcgtgccctggaggagatgaatgcagagctggaatgccgg
atcagagaacagtgtgaaggcgacatcccactggtgtgccctgattatcagtgttacttt
gacaccattgaagatctccaacaaaagatcttgtgcacgaaggcagagaattctagactt
gctgtacagctcgacaactgcaaactggcggctgatgactttaggtcaaagtacgagtct
gaactgtctcttcaccagctggtagagactgacatcggcagcctgcgtgggatcctgggt
gagctgaccctgtgcaaagccaatctggaggcccacgtggagtctctgaaggaagatctc
ctttgccttaagaaaaaccataaagaggaggtcaacttgcttcatggacagcttggtgac
cgactcactgtggagctaaacagtgaccccaccatggacctcaacagcgtcctggatgag
atgcgctgtcagtatgaaacggtgctcgccaacaaccgcagagacgcggaagaatggttc
accattcaggtcagcacctggcgcgatacaacgacaggcttccaggcttctgccttattt
gcattctctaatttaatcgtgcctgtgtttcagacgcaggagctgaatcagcagcagctg
tccagtgcagagcagctgcagggctgccagacagagatcttggaactgaaacgcacagcc
aatgctctggaaattgagctccaagcacagcaaagcctgacagaatctctggaatgcact
gtggcagaaactgaggcccagtacagcacccagctggcccagatccagtgcctgatcgac
aacgtggagaaccagctggccgagatccgctgcgacctggagcggcagaaccaggagtac
gaggtgctgctggacacgaaggcccgcctggagggcgagatcaacacataccggggtctc
ctggagagcgaggacagcaggcttccctgtaacccatgttctacaacaagcacgtcaagc
aacacttgtgagccgtgctcagcatatgtgctttgcacagtcgaaaactgctgtgtgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513774
Entry
107513774         CDS       T06036                                 

Gene name
KRT20
Definition
(RefSeq) keratin, type I cytoskeletal 20
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513774 (KRT20)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513774 (KRT20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513774 (KRT20)
   04147 Exosome [BR:ray04147]
    107513774 (KRT20)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513774 (KRT20)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513774 (KRT20)
  Exosomal proteins of other body fluids (saliva and urine)
   107513774 (KRT20)
  Exosomal proteins of colorectal cancer cells
   107513774 (KRT20)
  Exosomal proteins of melanoma cells
   107513774 (KRT20)
SSDB
Motif
Pfam: Filament Prominin Spc7 DUF1796
Other DBs
NCBI-GeneID: 107513774
NCBI-ProteinID: XP_016006284
LinkDB
Position
Unknown
AA seq 404 aa
MRGMYKGVNQHRRVPPSVYGGAGGHGTRISNSGHWVNYGNGDLLFGNEKMTMQNLNDRLA
SYLEKVRTLDQFNSKLEKKVKQWYEKNAPSTSRDYSAYYRQIEELKNQIKKAQQEKARCV
LKVDNAKLTAEDFRLKYETERGMRVAVEADLQGLSKFFDDLTLYKTDLEIQIEQLNKELI
ILKKEHQEEVDGLRKQLGNTVNVRLNAVPGKSLSAIIDEMRQKYEALAQENLQKAKGQFK
IQTETLQQQVTVNAADLKDSEIQLKELSRTYRNLSINLKSHLSMKDSLEHTLQDTKARYH
RQLAAIQKLLNTLEAQMMQIRTDAKRQNKEFDALLDIKTRLEQEIATYCRLLEGEDMKVS
TTGYQISILEGGEIKKTRKIRTVVQEVVVDGKVVTSEMKEMESA
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgagaggcatgtataagggggtcaatcagcaccggagggttccacccagtgtctatggg
ggagctgggggccatggcacccgcatctcgaactccggacactgggtgaactatggaaat
ggtgacctgctttttggcaatgagaagatgaccatgcagaacctaaatgaccgcctagca
agctacctagaaaaagtgcggaccctggatcaatttaactccaaacttgagaaaaaggtc
aagcagtggtatgaaaaaaacgcacccagcaccagtcgagactacagcgcatattacaga
caaatcgaagagctgaaaaatcagattaaaaaggctcaacaagaaaaagctcgatgtgtc
ctgaaagttgacaatgctaaactgaccgctgaggacttcagactgaagtatgagactgaa
agagggatgcgcgtagcagtggaggccgatctccaaggcctttctaagttctttgatgac
ctaaccctatataaaacagacttggagattcaaattgaacaactgaataaagaactgatt
atcctcaaaaaagaacatcaggaggaagtggatggcctacgcaagcagctgggcaacact
gtcaatgtgcggctgaatgcagttccaggcaagagcctcagtgccatcattgatgaaatg
aggcagaaatatgaagcgttggcccaggagaaccttcagaaggccaaaggacagtttaaa
atacagactgaaactctgcagcaacaagtcacagtgaacgctgcagatttaaaagacagt
gagatccaactaaaggagctgagtcgcacctaccggaacttgagcataaacctcaagtcc
catctcagcatgaaagactctttggagcatacactgcaggataccaaagcccgttatcat
agacagctggccgccatccagaaactgctaaacactctagaggcccaaatgatgcagata
cggactgatgcaaaacgccagaacaaagaattcgatgctctccttgacataaagacccga
cttgagcaggaaattgctacttactgtcgccttctggaaggagaagatatgaaggtaagc
actacaggatatcagataagcatcttggagggcggagagataaagaaaaccaggaagatt
aggacagtcgtgcaagaagtggtagtggacggcaaggttgtgacatctgaaatgaaagag
atggaatctgcgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513792
Entry
107513792         CDS       T06036                                 

Definition
(RefSeq) keratin, type I cuticular Ha7-like
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513792
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513792
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513792
   04147 Exosome [BR:ray04147]
    107513792
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513792
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513792
  Exosomal proteins of other body fluids (saliva and urine)
   107513792
  Exosomal proteins of colorectal cancer cells
   107513792
  Exosomal proteins of melanoma cells
   107513792
SSDB
Motif
Pfam: Filament DUF5082
Other DBs
NCBI-GeneID: 107513792
NCBI-ProteinID: XP_016006303
LinkDB
Position
Unknown
AA seq 434 aa
MTSFFVSSSPSLGSITIPEERNVCIPCIDVEGQPAAEARAASLGLSATVAHANRVRVGTT
PLGQPSLCLPPSCNTACPLPGTCHVPSNIGNCGAYGEGSLNGHEKVTMQFLNDRLANYLE
KVRQLERDNAELETKIREWSKCHESTVCPDYQSYFRSIEELQQKILCSKAENARLISQID
NAKLAADDFRIKHESERALRLLVEADMCGMQKLLDDMSLARADLEAQQESLKEEQLSLKS
NHEQEVNTLRCQLGDRLQIELDAEPTVDLSRVLEAMRCQYEAMVETNRRDVEQWFQAQSE
GISLQATSCSEELQCCQSEILELRCTVNALEVERQAQHNLKDCLQNSLCESEARYGTELA
QMQSLISTVEEQLSEIRADLERQNQEYQVLLDVRARLEGEIDTYRKLLESEDCKLPCNPC
STPASCTLRPSCAP
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgacttccttcttcgtcagctcctccccctctctgggcagcatcacgattcccgaggaa
agaaacgtctgtatcccctgcatcgatgttgagggccagcctgcggcagaggccagggct
gcctccctgggcctctcggccaccgtggcacacgccaaccgagtccgtgtggggacgacc
cccctgggccaacccagcctctgtctgccccccagctgcaacaccgcgtgccccttgcca
gggacctgccacgttcccagcaacatcggaaactgtggggcctacggtgaaggcagcctg
aacggccacgagaaggtgaccatgcagttcctgaacgaccggctggccaactacctggag
aaggtgcgtcagctggagcgggacaacgcggagctggagaccaagatccgagagtggagc
aaatgccacgagtccaccgtgtgcccggactaccagagctacttccggagcatcgaggag
ctgcagcagaagatcctgtgcagcaaggcggagaatgccaggctgattagccaaattgac
aatgccaagctggccgcggatgacttcagaatcaagcacgagagtgagcgcgccctgcgc
ctgctggtggaggcggacatgtgcggcatgcaaaagctcctggatgacatgagcctggcc
agggccgacctggaggcccaacaggagtcgctgaaggaggagcagctctccctcaagagc
aaccatgagcaggaagtgaacaccctgaggtgccagctgggggacaggctccagatcgag
ctggacgctgagcccaccgtggacctgagcagggtgctggaggcgatgcggtgccagtac
gaggccatggtggagaccaaccggcgcgatgtggagcagtggttccaagctcagtccgag
ggcatcagcctgcaggccacgtcctgctccgaggagctgcagtgctgccagtcggagatc
ctggagctgaggtgcacggtgaatgccctggaggtggagcgccaagcccagcacaacctg
aaggactgcctgcagaactccctgtgtgagtccgaggcccgctacggcaccgagctggcc
cagatgcagagcctgatcagcaccgtggaggagcagctgtctgagatccgggccgacctg
gagcggcagaaccaggagtaccaggtgctgctggacgtgcgggcccggctggagggcgag
atcgacacgtaccggaagctcttggagagcgaggactgcaaacttccttgcaatccatgc
tctacgcctgcctcctgtacccttcgtccaagctgtgccccctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513793
Entry
107513793         CDS       T06036                                 

Gene name
KRT38
Definition
(RefSeq) keratin, type I cuticular Ha8
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513793 (KRT38)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513793 (KRT38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513793 (KRT38)
   04147 Exosome [BR:ray04147]
    107513793 (KRT38)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513793 (KRT38)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513793 (KRT38)
  Exosomal proteins of other body fluids (saliva and urine)
   107513793 (KRT38)
  Exosomal proteins of colorectal cancer cells
   107513793 (KRT38)
  Exosomal proteins of melanoma cells
   107513793 (KRT38)
SSDB
Motif
Pfam: Filament DUF5082
Other DBs
NCBI-GeneID: 107513793
NCBI-ProteinID: XP_016006305
LinkDB
Position
Unknown
AA seq 457 aa
MASFFVSSSPSVGSITIPEERNVCIPCIDVGGQPAAEARAASLGLSATVAHANRVRVGTT
PLGRPSLCLPPSCNTACPLPGTCHVPGNIGNCGAYGEGSLNGHEKVTMQFLNDRLANYLE
KVRQLERDNAELETKIREWSKCHESTVCPDYQSYFRSIEELQQKILCSKAENARLISQID
NAKLAADDFRIKHESERALRLLVEADMCGMQKLLDDMSLARADLEAQQESLKEEQLSLKS
NHEQEVNTLRCQLGDRLQIELDTEPTVDLSRVLEAMRCQYEAMVETNRRDVEQWFQAQSE
GISLQATSCSEELQCCQSEILELRCTVNALEVERQAQHNLKDCLQNSLCESEARYSTELA
QMQSLISTVEEQLSEIRADLERQNQEYQVLLDVRARLEGEIDTYRKLLESEDCKLPCNPC
STPASIVPLSCAPFPSCAPHTTCGPGSPQGAVTGNRF
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggcttccttcttcgtcagctcctccccctctgtgggcagcatcacgattcccgaggaa
agaaacgtctgtatcccctgcatcgatgttgggggccagcctgcggcagaggccagggct
gcctccctgggcctctcggccaccgtggcacacgccaaccgagtccgtgtggggacgacc
cccctgggccgacccagcctctgtctgccccccagctgcaacaccgcgtgccccttgcca
gggacctgccacgttcccggcaacattggaaactgtggggcctacggtgaaggcagcctg
aacggccacgagaaggtgaccatgcagttcctgaacgaccggctggccaactacctggag
aaggtgcgccagctggagcgggacaacgcggagctggagaccaagatccgagagtggagc
aaatgccacgagtccactgtgtgcccggactaccagagctacttccggagcatcgaggag
ctgcagcagaagatcctgtgcagcaaggcggagaatgccaggctgattagccaaattgac
aatgccaaactggccgcggatgacttcagaatcaagcatgagagtgagcgcgccctgcgc
ctgctggtggaggcggacatgtgcggcatgcaaaagctcctggatgacatgagcctggcc
agggccgacctggaggcccagcaggagtcgctgaaggaggagcagctctccctcaagagc
aaccacgagcaggaagtgaacaccctgaggtgccagctgggggacaggctccagatcgag
ctggacactgagcccaccgtggacctgagcagggtgctggaggcgatgcggtgccagtac
gaggccatggtggagaccaaccggcgcgatgtggagcagtggttccaagctcagtccgag
ggcatcagcctgcaggccacgtcctgctccgaggagctgcagtgctgccagtcggagatc
ctggagctgaggtgcacggtgaacgccctggaggtggagcgccaagcccagcacaacctg
aaggactgcctgcagaactccctgtgtgagtctgaggcccgctacagcaccgagctggca
cagatgcagagcctgatcagcactgtggaggagcagctgtctgagatccgggccgacctg
gagcggcagaaccaggagtatcaggtgctgctggacgtgcgggcccggctggagggcgag
atcgacacgtaccggaagctcttggagagcgaggactgcaagcttccttgcaatccgtgc
tccacacctgcctccattgtgcctctctcctgtgctccttttccgagctgtgcccctcac
actacttgtgggcctggttcaccccaaggagctgtcaccggaaaccggttctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513794
Entry
107513794         CDS       T06036                                 

Definition
(RefSeq) keratin, type I cytoskeletal 15
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513794
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513794
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513794
   04147 Exosome [BR:ray04147]
    107513794
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513794
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513794
  Exosomal proteins of other body fluids (saliva and urine)
   107513794
  Exosomal proteins of colorectal cancer cells
   107513794
  Exosomal proteins of melanoma cells
   107513794
SSDB
Motif
Pfam: Filament Atg14 TPR_MLP1_2 Baculo_PEP_C DUF1664 DUF4407
Other DBs
NCBI-GeneID: 107513794
NCBI-ProteinID: XP_016006306
LinkDB
Position
Unknown
AA seq 449 aa
MSTTFLQTSSSTFGGSSTRGGSLRAGGGSFGGGSLYTGGGGRSISASSARFVSSGSGGGY
GGGMSYGFGGGAGSGFGGGFGGGFGDFGGGDGGLLSGNEKITMQNLNDRLASYLDKVRAL
EEANADLEVKIRDWYQKQSPASPERDYSHYFKTIEELRDKILAATIDNSRVILEIDNARL
AADDFRLKYENELALRQSVEADINGLRRVLDELTLAKADLEMQIENLNEELVYLKKNHEE
EMREFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAIAEKNRRDAEAWFFSKTEELNK
EVASNTEMIQTSKTEITDLRRTMQGLEIELQSQLSMKAGLESSLAETECRYATQLQQIQG
LISGLETQLSELRCEMEAQNQEYKILLDIKTRLEQEIATYRSLLEGQDARMAGIGTREAS
LGGGSSGKLHINVEESVDGKVVSSRKREI
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgagcaccacgtttctgcagacttcttcctccacctttgggggtagctctacgcggggg
ggttccctccgagctgggggaggcagctttggtggagggagtctctacacgggaggtgga
ggacgaagtatctcggcttcttctgccaggtttgtctcttcagggtcaggagggggctat
gggggaggcatgagctatggcttcggtggaggggctgggagtggtttcggtggaggcttt
ggaggtggctttggtgactttggtggtggcgatggcggcctcctctctggcaatgagaag
atcaccatgcagaacctcaacgaccgcctggcctcctacctggacaaggtgcgcgccctg
gaggaggccaacgccgacctggaggtgaagatccgcgactggtaccagaagcagagcccc
gccagcccggagcgcgactacagccactacttcaagaccatcgaggaactccgggacaag
atcctggcagccaccatcgacaactcccgggtcatcctggagatagacaacgccaggctg
gctgcggacgacttcaggctcaagtatgagaacgagctggccctgcgccagagtgtggag
gccgacatcaacggcctgcgcagggtgctggacgagctgaccctggccaaggcggacctg
gagatgcagatcgagaacctgaatgaggagctggtctacctgaagaagaaccacgaggag
gagatgagggagttcagtagccagctggccggccaggtcaatgtggagatggacgcagcc
ccaggcgtggacctgacccgcgtgctggcggagatgagggagcagtacgaggccatagca
gagaagaaccgccgcgatgccgaggcctggttcttcagcaagaccgaggagctgaacaag
gaggtggcctccaacacagagatgatccagactagcaagacagagatcacagacctgaga
cgcaccatgcaggggctggagattgagctgcagtcccagctcagcatgaaagccgggctg
gagagctcgctggcggagaccgagtgccgctacgccacgcagctgcagcagatccagggg
ctcatcagtggcctggagacccagctgagtgagctgcgctgtgagatggaggctcagaac
caggagtacaagatcctgctggacatcaagacacggctggagcaggagatcgccacctac
cgcagtctgctcgagggccaggatgccaggatggctggcattggcaccagagaagcctcc
ctgggaggtggcagcagcggcaaactccacatcaacgttgaggagtcagtggatgggaag
gtggtttcttcccgaaagagagaaatctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513795
Entry
107513795         CDS       T06036                                 

Definition
(RefSeq) keratin, type I cytoskeletal 13-like
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513795
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513795
   04147 Exosome [BR:ray04147]
    107513795
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513795
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513795
  Exosomal proteins of other body fluids (saliva and urine)
   107513795
  Exosomal proteins of colorectal cancer cells
   107513795
  Exosomal proteins of melanoma cells
   107513795
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Prefoldin Atg14
Other DBs
NCBI-GeneID: 107513795
NCBI-ProteinID: XP_016006307
LinkDB
Position
Unknown
AA seq 439 aa
MSCRLQTSSASYGGGFGGGSCQLGGGRFVSGGSAGGYGGGVSCGFGGGAGSGFGGGFGGG
FGGGFGGGFGGGFGDFGGGDGGLLSGNEKITMQNLNDRLASYLEKVRALEEANTDLEVKI
RDWHQKQSPASPERDYSHYYKIIEELRDKILAATIDNNRVILEIDNARLAADDFRLKYEN
ELALRQSVEADINGLRRVLDELTLAKTDLEMQIESLNEELAYLKKNHEEEMKEFSNQVVG
QVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFNSKSAELNKEVSSNTAMIQT
SKTEITELRRTLQGLEIELQSQLSMKAGLESTVADTECRYATQLAQIQSLISCIEAQLSD
VRADTERQNLEYRQLMDIKSRLEQEIATYRSLLEGQDAKIIGFDSSRGTTHTGNSATTSG
PSSGNRASETRRPSEIRRP
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgagctgtcgcctgcagacctcttccgccagctatggaggtggttttgggggtggttcc
tgccagctgggaggaggccggtttgtctctgggggatcagctgggggatatgggggcggc
gtgagctgcggcttcggtggaggggctggtagtggttttggaggtggctttggaggtggc
tttggaggtggcttcggtgggggttttggcggtggctttggtgactttggtggtggcgat
ggcggcctcctctctggcaatgagaagatcaccatgcagaacctcaacgaccgcctggcc
tcctacctggagaaggtgcgcgccctggaggaggccaacactgacctggaggtgaagatc
cgcgactggcaccagaagcagagccccgctagcccggagcgtgactacagtcactactac
aagatcatagaggagctccgggacaagatcctggcggccaccatcgacaacaaccgggtc
atcctagagatcgacaatgccaggctggctgctgatgacttcaggctcaagtatgagaat
gagctggccctgcgccagagtgtggaggccgacatcaacggcctgcgcagggtgctggac
gagctgaccctggccaagacggacctggagatgcagatcgagagcctgaatgaggagctg
gcctacctgaagaagaaccatgaggaggagatgaaagagttcagcaaccaggtggtaggc
caggtcaacgtggagatggatgctacccctggcattgacctgacccgcgtgctggcagag
atgagagagcagtacgaggccatggcagagaggaaccgccgcgatgccgaggaatggttc
aacagcaagagtgcagagctgaacaaggaggtgtcttccaacactgccatgattcagacc
agcaagacggagatcacggagctcaggcgtacgctccagggcctggagatcgagctgcag
tcccagctcagcatgaaagccgggctggagagcacggtggcagacacggagtgccgctac
gccacgcagctggctcagatccagtctttgatcagctgcatcgaagcccagctgagcgac
gtgcgggctgacaccgagaggcagaacctggagtaccggcagctcatggacatcaagtcg
cggctggagcaggagatcgccacctaccgcagcctgctcgagggccaggacgccaagatt
attggcttcgacagctcaagaggaaccacccacaccggcaacagcgctactacctccggc
cccagttccggcaaccgcgcttcggagacccgcaggccttcggaaatccgtaggccttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513796
Entry
107513796         CDS       T06036                                 

Gene name
KRT19
Definition
(RefSeq) keratin, type I cytoskeletal 19
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513796 (KRT19)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513796 (KRT19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513796 (KRT19)
   04147 Exosome [BR:ray04147]
    107513796 (KRT19)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513796 (KRT19)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513796 (KRT19)
  Exosomal proteins of other body fluids (saliva and urine)
   107513796 (KRT19)
  Exosomal proteins of colorectal cancer cells
   107513796 (KRT19)
  Exosomal proteins of melanoma cells
   107513796 (KRT19)
SSDB
Motif
Pfam: Filament DUF4407 TPR_MLP1_2 Spc7 DUF4600 DUF4201 Bacillus_HBL Prefoldin ADIP Nas2_N
Other DBs
NCBI-GeneID: 107513796
NCBI-ProteinID: XP_016006308
LinkDB
Position
Unknown
AA seq 400 aa
MTSYSYRQSSASSSFGGLGGGAMRFGSGGAFRAPSIHGGSGGRGVSVSSARFVSSSSSGG
YGGGYAGALVGSDGLLAGNEKVTMQNLNDRLASYLDKVRALEAANGDLEVKIRDWYQKQG
PGPARDYSHYYKTIEELRDKILGATIENSKIVLQIDNARLAADDFRTKFETEQALRMSVE
ADINGLRKVLDELTLARADLEMQIEGLKEELAYLKKNHEEEISVLKGQVGGQVSVEVDSA
PGIDLAKILSDMRSQYEVMAEKNRKDAEAWFTSQTEELNREVAGHTEQLQISKTEVTDLR
RTLQGLEIELQSQLSMKAALEGTLAETEARFGAQLAQIQALISSIEAQLSDVRADTERQN
LEYQQLMDIKSRLEQEIATYRSLLESQDAYYNNLLTTKTA
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgacttcctacagctatcgccagtcgtcggcctcctcgtccttcgggggcctgggcggt
ggcgccatgcgcttcgggtcgggaggcgccttccgtgcgccgagcatccacgggggatcg
ggcgggcgcggcgtgtcggtatcctccgctcgtttcgtgtcctcgtcctcctctgggggc
tacggcggcggctatgcgggcgccctggtcgggtccgacgggctgctggcgggcaacgag
aaggtgaccatgcagaacctcaacgaccgcctggcctcctatctggacaaggtgcgcgcc
ctggaggcggccaacggtgacctggaagtgaagatccgcgactggtaccagaagcagggg
cccgggcccgcccgcgactacagccactactacaagaccatcgaggaactgcgggacaag
atacttggtgccaccatcgagaactccaaaattgtcctgcagattgacaatgcccgtctg
gctgctgatgacttccgaaccaagttcgagacggagcaggccctgcgcatgagtgtggag
gctgatatcaatggcctgcgcaaggtgctggacgagctgaccctggccagagccgaccta
gagatgcagattgaaggcctgaaggaagagctggcgtacttgaagaagaaccacgaggag
gaaatcagtgttctgaagggccaggtgggtggccaggtcagtgtggaggtggattctgct
ccaggcatcgacctagccaagatcctgagtgacatgagaagccaatatgaggtcatggct
gagaagaaccggaaggatgctgaagcctggttcaccagccagactgaggagctgaaccgg
gaggttgctggccacaccgagcagctgcaaattagcaagacagaagtcaccgacctgagg
cgtactcttcagggtctggagatcgagctgcagtctcagctcagcatgaaagctgccctg
gaaggcacgctggcagaaacagaggctcgctttggagcccagctggcacagatccaggca
ttgatcagcagtatcgaagcccagctgagtgacgtgcgggccgacactgagcggcagaac
ttggagtaccagcagctcatggacatcaagtcgcggctggagcaggagatcgccacctac
cgcagcctgcttgagagccaggacgcatattacaacaacctgctcaccactaagaccgcc
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513868
Entry
107513868         CDS       T06036                                 

Gene name
KRT24
Definition
(RefSeq) keratin, type I cytoskeletal 24 isoform X1
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513868 (KRT24)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513868 (KRT24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513868 (KRT24)
   04147 Exosome [BR:ray04147]
    107513868 (KRT24)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513868 (KRT24)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513868 (KRT24)
  Exosomal proteins of other body fluids (saliva and urine)
   107513868 (KRT24)
  Exosomal proteins of colorectal cancer cells
   107513868 (KRT24)
  Exosomal proteins of melanoma cells
   107513868 (KRT24)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Hanta_nucleocap Gp58 APG6_N YabA FlxA Jnk-SapK_ap_N SPATA1_C
Other DBs
NCBI-GeneID: 107513868
NCBI-ProteinID: XP_016006471
LinkDB
Position
Unknown
AA seq 518 aa
MSCSSRISSSRAGGSCSVRVSAGGGSFSSGSRCGLGGGSTRGFHGGASSCGLSGGSSGGF
GGGFGGGFGSCSVGGGFGVASGSGAGFGGGSGFGGGSGFGGGASGGFYSYGGGMVGGVGD
GGLFSGGEKQTMQNLNDRLASYLDKVRALEEANADLEIKIKEWYDRHGPGSKDGGSGRDY
SKYYPIIEDLKNQIITATTENAGIVLQIDNARLAADDFRLKYENELHLRQTVEADINGLR
KVLDDLTMTRSDLEMQIEGLTEELAYLKKNHEEEIKSMQGSSGGDVTVEMNAAPGTDLTK
LLNDMRAQYEALAEQNRREAEEQFNKQSASLQAQISTDAGAASSAKSEITELKRTLQALE
IELQSQLAMKSSLEGTLADTEAGYVAQLSEIQVRISSLEEQICQIRGETECQNAEYEQLL
DIKTRLEMEIETYRRLLDGEGSGSCFSGSDFRNSGSRNVGSRSSGSRDSISGDSRSGSHS
GQGRDPSKTRVTKTIIEEVVDGKVVSSQVSNVSEVKVK
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgtcttgctcatctcggatctcctcctcccgggctggaggcagctgctccgtcagggtg
tctgctggtggcggcagcttcagcagcggaagcagatgtggtctggggggcggctccacc
cggggcttccacggaggagctagcagttgtggcttaagcgggggatcaagtggtggcttt
ggaggtggctttggagggggttttggtagctgctcagtagggggtggttttggagtagct
tcaggctctggagctggctttggtggaggttctggctttggcgggggttctggatttggg
ggtggtgctagtggaggcttctacagctatggtggtggtatggttggtggtgttggcgat
gggggtcttttctctggaggtgaaaagcaaaccatgcagaacctcaatgaccgtctggcc
agctacctagacaaggtcagagccttggaggaggccaacgctgatctggaaatcaaaatc
aaggagtggtatgacagacatgggcctgggtctaaagatggtggatctggtagagattac
agcaaatactatccaataattgaagatctcaagaatcagatcattactgccactactgaa
aatgctgggattgtgttgcagatcgacaatgccagactggctgctgatgacttcagactg
aagtatgagaacgagctgcatctccggcagaccgtggaggccgacatcaacggcctaagg
aaagtcctggacgacctgaccatgactcgctccgacctggagatgcagatcgagggcctc
accgaggagctggcctacctgaagaagaaccatgaggaagaaattaagagtatgcaagga
agctccggaggggatgtgacagtagaaatgaatgccgccccaggaaccgacctgaccaag
ttactgaatgacatgagggcacagtatgaggctctggctgagcaaaaccgccgggaggca
gaggagcagttcaacaagcagagtgcatcactgcaagcacagatctctactgatgctggg
gcagccagttctgccaagagtgagataacagaactgaaacggactctgcaggccctggaa
attgagcttcagtcccagctggccatgaaaagctccctagaagggaccctggctgacaca
gaagctggctacgtggctcagctgtcagaaattcaagtgcggatcagcagcctggaggag
cagatctgccagatccggggcgagaccgaatgtcagaacgcggaatacgagcagctgctg
gacatcaagacccgtctggagatggagatcgagacctaccgccgcctgctggacggcgag
ggcagtggctcttgttttagtggatcagattttagaaactcgggatccagaaatgtgggg
tccaggagctcggggtccagggattccatctctggtgactcaagatctggaagccattct
ggtcaaggaagagatccgagcaagaccagagtgacgaagaccatcatagaggaggtggtg
gatggcaaagtcgtctcttctcaagtcagcaatgtttctgaggtgaaggtcaaatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513869
Entry
107513869         CDS       T06036                                 

Gene name
KRT25
Definition
(RefSeq) keratin, type I cytoskeletal 25
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513869 (KRT25)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513869 (KRT25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513869 (KRT25)
   04147 Exosome [BR:ray04147]
    107513869 (KRT25)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513869 (KRT25)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513869 (KRT25)
  Exosomal proteins of other body fluids (saliva and urine)
   107513869 (KRT25)
  Exosomal proteins of colorectal cancer cells
   107513869 (KRT25)
  Exosomal proteins of melanoma cells
   107513869 (KRT25)
SSDB
Motif
Pfam: Filament FliJ TPR_MLP1_2 Phage_Mu_Gam
Other DBs
NCBI-GeneID: 107513869
NCBI-ProteinID: XP_016006474
LinkDB
Position
Unknown
AA seq 450 aa
MSLRLSSGSRRACPRPTTGSLRLSGGGASFGAGNACSMSGIGSGFSCTFGGSASGGNTGG
SNSCAGFTVNEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANADLEQKIKGWYEKFGP
GSCRGLDHDYSRYFPIIDDLKNQIIASTTSNANTVLQIDNARLTADDFRLKYENELALHQ
SVETDVNGLRRVLDEITLCRTDLEIQYETLSEEMTYLKKNHKEEMQVLQCAAGGNVNVEM
NAAPGVDLTVLLNNMRAEYEDLAEQNRRDAEAWFNEKSASLQQQISEDVGATTSARNELT
EMKRNLQTLEIELQSLLATKHSLECSLSETEGNYCAQLAQIQAQIGALEEQLHQVRTETE
GQKLEYEQLLDIKVHLEKEIETYCLLISGDDGACKSGGYKSKDYGSGNIGNQVKDPAKAI
VVKKVLEEVDQRSKILTTRLHSLEEKAQNN
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgtctcttcgactttccagtggatccagaagggcctgtccccgtcccaccacaggatca
ctcaggctctcaggtgggggagccagctttggggctggaaatgcttgcagcatgtctgga
attggaagtggcttctcatgtaccttcgggggcagtgcatcgggaggaaatacaggcgga
agcaattcctgtgctggctttactgtgaatgaggggggcctcctttctggcaatgagaag
gtgaccatgcagaacctcaacgaccgcctggcgtcctacctggacaatgtgcgtgctctg
gaagaggcaaatgcagacctggaacagaagatcaagggctggtatgagaaatttgggcct
ggttcttgccgtggtcttgatcatgactatagcagatatttccctataatcgatgacctc
aaaaatcagatcatcgcttctactaccagcaatgctaatactgttctacagattgataat
gccagactgacagctgatgatttccgactcaagtatgaaaatgagctggctcttcaccag
agtgtagagaccgatgtcaatgggttacgcagagttctggatgaaatcaccctgtgcaga
acagacctcgagattcagtatgaaaccctgagtgaggagatgacttatctcaaaaagaac
cataaggaggaaatgcaagttcttcagtgcgccgctgggggcaacgtgaatgtggagatg
aacgcggcgcctggcgtggacctcacggttctgctgaacaacatgcgggctgagtacgag
gacctcgccgagcagaaccgccgggatgcggaggcctggttcaacgagaagagcgcttct
ctgcagcagcagatctctgaggacgtgggagccaccacctctgcccggaatgagctgact
gagatgaagcgcaatctccaaacactggaaattgaacttcagtctctcctagcgacgaaa
cactccctggagtgctccttgtcggagacagaaggcaactactgtgcacagctggcccag
atccaggctcagatcggggccctggaggagcagctgcaccaggtccgaaccgagactgag
ggccagaagctggagtacgagcagctcctggacatcaaggtccacctggaaaaggaaatc
gagacctactgcctcctcatcagtggagatgatggggcttgcaagtctggaggttacaag
tctaaagattatggatctggaaacatagggaatcaagtcaaagatccagccaaagccata
gtggttaagaaagtccttgaggaggtagaccaacgcagcaaaatacttaccaccaggctc
cactccctggaagagaaagctcaaaacaattaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513870
Entry
107513870         CDS       T06036                                 

Gene name
KRT26
Definition
(RefSeq) keratin, type I cytoskeletal 26
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513870 (KRT26)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513870 (KRT26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513870 (KRT26)
   04147 Exosome [BR:ray04147]
    107513870 (KRT26)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513870 (KRT26)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513870 (KRT26)
  Exosomal proteins of other body fluids (saliva and urine)
   107513870 (KRT26)
  Exosomal proteins of colorectal cancer cells
   107513870 (KRT26)
  Exosomal proteins of melanoma cells
   107513870 (KRT26)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 FliJ DUF4791 V_ATPase_I YlqD AATF-Che1
Other DBs
NCBI-GeneID: 107513870
NCBI-ProteinID: XP_016006475
LinkDB
Position
Unknown
AA seq 468 aa
MSFRLSSGSRRVCSRAGSGRLSGGGIGFGAGNVCGGSGSGSSFSCTLGSISSGGGFYNGG
GGLGNGNCAGFLGNEHGLLSGNEKVTMQNLNDRLASYLDHVRALEEANSDLEQKIKDWYE
KYGPGSCRGLDHDYSIYLPVIEDLKRQIISATTCNASIFLQNDNARLTADDFRLKYENEL
ALHQSVEADINGLHRVMDELTLCTTDLGIQCETLSEELTYLKKNHNEEMEVLQCTAGGNV
NVEMNAAPGVDLTVLLNNMRAEYEDLAKQNRRDAEAWFHEKSSSLQQQISDDAGAATVAR
NELTELKRNLQTLEIELQSLMATRRSYECSLAETEGCYHLQLQQIQEQIGAMQEQLQQIR
TETEGQKLEYERLLDIKIILEKEIETYCTLIDGEERKSKSTFCKSKGYGPINSENQVKDS
KEETVVKAVVKELDHLGNVVSLTVHSVEEKSSKISNITMEQRVASKAP
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgtcctttagactttccagtggatccagacgggtctgctcacgagctggctctggtcga
ctgtccggtggaggaataggctttggggctgggaatgtatgtggtgggtcgggatcagga
agcagcttttcttgtactcttgggagcatttcttctggaggaggtttctataatggtggt
ggagggttggggaatggcaactgtgctggttttcttggaaatgaacatggccttctctct
ggaaatgaaaaggtgaccatgcagaatctcaatgaccgcctagcgtcctacttggaccat
gtgcgtgctctggaagaagcaaattcagaccttgagcagaaaatcaaggactggtatgag
aaatatgggcctggttcttgccggggactcgatcatgactatagtatatatttaccagtc
attgaagatcttaaaaggcagattatttctgcgaccacctgtaatgccagcatttttcta
caaaatgacaatgccagactgaccgctgatgacttcaggctgaagtatgaaaatgagctt
gctctacaccagagtgttgaggcggacatcaacggtctgcacagagtgatggacgagctg
accctttgtacaaccgacctggggatacagtgtgaaacactaagtgaagaattgacgtac
ctcaaaaaaaatcacaatgaagaaatggaggtcctgcagtgtacggcaggggggaacgtc
aatgtggagatgaatgcagccccgggagtggatctaactgttctgttgaacaatatgagg
gccgagtacgaggacttggccaagcagaaccgcagagacgccgaggcctggtttcatgag
aagagttcttcgctacagcagcagatttctgatgatgcaggcgctgccacggtagccaga
aatgagctgacggaactgaagcgcaatctgcaaaccctggaaatagaacttcagtccctc
atggccacgagacgttcctatgaatgctccttggccgagactgaaggctgttaccacctt
cagctccagcaaatccaggagcaaatcggggcgatgcaggaacagttgcagcagatccgg
acggaaacagaaggccagaagctggagtatgaacggcttctagatatcaaaatcattttg
gaaaaagaaattgaaacttactgcacattaatagatggagaagaaagaaaaagcaagtcc
acgttttgcaaatcaaaagggtatgggcccataaattctgaaaatcaagtcaaagattca
aaagaagaaactgttgtcaaagccgtggtcaaggagctagatcaccttggcaatgtcgtc
tcactgacagtccactcagttgaagaaaaatcctctaaaataagcaatattacaatggag
caacgagtagcttctaaagcaccatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513871
Entry
107513871         CDS       T06036                                 

Definition
(RefSeq) keratin, type I cytoskeletal 27 isoform X1
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513871
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513871
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513871
   04147 Exosome [BR:ray04147]
    107513871
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513871
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513871
  Exosomal proteins of other body fluids (saliva and urine)
   107513871
  Exosomal proteins of colorectal cancer cells
   107513871
  Exosomal proteins of melanoma cells
   107513871
SSDB
Motif
Pfam: Filament ATG16 FliJ TPR_MLP1_2 FlxA V_ATPase_I
Other DBs
NCBI-GeneID: 107513871
NCBI-ProteinID: XP_016006476
LinkDB
Position
Unknown
AA seq 460 aa
MSVRFSSASRRLGSCGAVGSGRMSSAGAGFGAGNTCGVSGFGSGFSCAFGGSSSAGGYGA
GLGGGSASCAAFIGNEHGLLSGNEKVTMQNLNDRLASYLENVRALEEANTELEQKIKGWY
EKFGPGSCRGLDHDYSRYFPIIDDLRNQIISATTTNASVILQNDNARLTADDFRLKFENE
QALHQSVDADVGSLRRVLDELTLCRTDLEIQLETLSEELAYLKKNHEEEMKALQCTAGGN
VNVEMNAAPGVDLTVLLNNMRAEYEDLAEQNRQDAEAWFHEKSASLQQQISDDAGATTSA
RNELTEMKRTLQTLEIELQSLLAMKHSLECSLSETEGNYCAQLAQIQAQIGALEEQLHQV
RTETEGQKLEYEQLLDIKVHLEKEIETYCRLIDGEDGSCVKSKGYKGPGNQIKESSKTTT
VKTIVEEIDPRGKVLSSKVHTTEEKPTKVNNIKSEQRVPS
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgtctgtgcgcttttcttctgcatccagacgtcttggctcttgcggggccgtgggctct
gggaggatgtctagtgcgggagctggctttggggccggaaacacatgcggtgtgtcaggt
tttggaagcggtttctcttgcgcctttgggggcagctcatctgcaggaggctacggcgcg
gggctgggagggggaagtgcttcctgtgcggccttcattggaaatgaacacggcctcctc
tcgggcaatgagaaggtgaccatgcagaacctcaatgatcgcttggcctcctacctggag
aacgtgagagcactagaggaggccaacaccgaactggagcagaagatcaaaggatggtat
gagaaatttggtcctggttcttgccgcggtcttgatcacgattacagcagatacttcccc
ataattgacgaccttaggaaccagataatttctgcaactacgactaatgccagtgttatc
ctgcaaaatgataacgcaagactaacggctgatgacttcagactaaagttcgaaaatgaa
caggcccttcaccagagcgttgacgcagatgtcggcagtttgcgcagggtcctagatgag
ttgactttgtgcagaaccgatctggagatccagctggaaactctgagtgaggagctggct
tacctcaagaagaatcacgaggaggaaatgaaggctctgcagtgcaccgctgggggcaac
gtgaatgtggagatgaacgcggcccctggcgtggacctcacggttctgctgaacaacatg
cgggctgagtacgaggacctcgccgagcagaaccgccaggatgcggaggcctggttccac
gagaagagcgcctcgctgcagcagcagatttctgacgacgctggcgccaccacctcagct
cggaatgaacttactgagatgaagcgtactcttcaaaccctggagattgaacttcagtcc
ctcttagcaatgaaacactccttagagtgctccttgtcggagacagaaggcaactactgt
gcacagctggcccagatccaggctcagattggggccctggaggaacagctgcaccaggtc
cgaaccgagaccgagggccagaagctggagtacgagcagctcctggacattaaggtccac
ctggaaaaagaaattgagacctactgccgcctgatagatggagaagatggctcttgtgtt
aaatcaaaaggctacaaaggaccagggaatcagataaaagagtcatctaaaaccaccacg
gttaaaacaattgttgaagaaatagatcctcgtggtaaagttctctcatctaaagttcat
accacagaagagaaacccaccaaagtcaacaacatcaagagtgaacagagggtgccttcc
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513872
Entry
107513872         CDS       T06036                                 

Gene name
KRT33A
Definition
(RefSeq) keratin, type I cuticular Ha3-I
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513872 (KRT33A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513872 (KRT33A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513872 (KRT33A)
   04147 Exosome [BR:ray04147]
    107513872 (KRT33A)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513872 (KRT33A)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513872 (KRT33A)
  Exosomal proteins of other body fluids (saliva and urine)
   107513872 (KRT33A)
  Exosomal proteins of colorectal cancer cells
   107513872 (KRT33A)
  Exosomal proteins of melanoma cells
   107513872 (KRT33A)
SSDB
Motif
Pfam: Filament Lzipper-MIP1 TPR_MLP1_2 Lipoprotein_7 Uso1_p115_C DUF4677 SKA1
Other DBs
NCBI-GeneID: 107513872
NCBI-ProteinID: XP_016006478
LinkDB
Position
Unknown
AA seq 404 aa
MSYNCCLPNFSCRSSCPSRPCVAPSCQNIPLPGACNIPANVGSCGWFCEGTFNGSEKEAM
QFLNDRLASYLEKVRQLERENAELESLIQERCQQQEPLMCSSYQSYFRTIEELQQKILCS
KSENSRLVVQIDNAKLAADDFRTKYETEVGLRQLVESDINSLRRILDELTLCRADLEAQV
ESLKEELLCLKQNHEQEVNTLRCQIGDRLNVEVDAAPTVDLNRVLNETRCQYEALVETNR
RDVEEWFTTQTQELNKQVVSSSEQLQTCQAEIIELRRTVNALEIELQAQHNLRNSLENTL
TETEARYSSQLSQVQCMITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRGLL
ESEDCKLPCNPCATTNACDKPIGPCVSNPCAPRTRCGPCNSFVC
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcttacaactgctgcctgcctaacttcagctgccgctccagctgcccctcccggccc
tgcgtggcccccagctgccaaaacatccccctgcctggggcctgcaacatccccgccaac
gtgggcagctgcggctggttctgcgagggcaccttcaatggcagcgagaaggaggccatg
cagttcctgaatgaccggctggccagctacctggagaaggtgcgccagctggagcgggag
aacgcggagctggagagcctcatccaggagcggtgccagcagcaggagcccctgatgtgc
tccagctaccagtcctacttccggaccatcgaggagctccagcagaagatcctgtgtagc
aagtctgagaattccaggctggtggtacagattgacaatgccaagctggccgcggatgac
tttaggaccaagtatgagacggaggtgggcttgcggcagctggtggagtcggacataaac
agtctgcgcaggatcctggacgagctgaccctatgcagggccgacctggaggcccaggtg
gagtctctgaaggaagagctgctctgcctcaagcagaaccacgagcaggaagtcaacacc
ctgcgctgccagattggagaccgcctcaacgtggaggtggacgccgcccccaccgtggac
ctgaaccgcgtgctcaacgagaccaggtgtcagtacgaggccctggtggagaccaaccgc
agggacgtggaggaatggttcaccacccagacccaggagctgaacaagcaggtggtgtcc
agctcggagcagctgcagacctgccaggcagagatcatcgagctgagacgcacggtcaac
gccctggagatcgagctgcaagcccagcacaacctgaggaactctctggagaacacgctg
acggagacggaggcccgctacagctcccagctgtcccaggtgcagtgcatgatcaccaac
gtggagtcccagctggctgagatcaggagtgaccttgagcggcagaaccaggagtaccag
gtgctgctggacgtccgggcccggctggagtgcgagatcaacacgtaccggggcctgctg
gagagcgaggactgcaagctcccctgcaacccatgtgccacaaccaatgcatgtgacaag
cccattgggccctgcgtctccaatccttgtgccccacgtacccggtgtgggccttgcaac
agctttgtgtgctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513873
Entry
107513873         CDS       T06036                                 

Definition
(RefSeq) keratin, type I cuticular Ha3-I-like
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513873
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513873
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513873
   04147 Exosome [BR:ray04147]
    107513873
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513873
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513873
  Exosomal proteins of other body fluids (saliva and urine)
   107513873
  Exosomal proteins of colorectal cancer cells
   107513873
  Exosomal proteins of melanoma cells
   107513873
SSDB
Motif
Pfam: Filament Lzipper-MIP1 TPR_MLP1_2 DUF4677 Uso1_p115_C Baculo_PEP_C SKA1
Other DBs
NCBI-GeneID: 107513873
NCBI-ProteinID: XP_016006479
LinkDB
Position
Unknown
AA seq 407 aa
MPYNCCLPNFSCRSSCLSRPCVAPSCQNIPLPGACNIPANVGNCGWFCEGTFNGSEKEAM
QFLNDRLASYLEKVRQLERENAELESLIQERCQQQEPLMCSSYQSYFRTIEELQQKILCS
KAENARLVVQIDNAKLAADDFRTKYETELGLRQLVESDINSLRRILDELTLCRSDLEAQV
ESLKEELLCLKQNHEQEVNTLRCQIGDRLNVEVDAAPTVDLNRVLNETRCQYEALVETNR
RDVEEWFTTQTQELNKQVVSSSEQLQTCQAEIIELRRTVNALEIELQAQHNLRNSLENTL
TETEARYSSQLSQVQCMITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRGLL
ESEDCKLPCNPCATTNACDKPIGPCVTNPCGPCGPRTRCGPCSTVGC
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgccttacaactgctgcctgcccaacttcagctgccgctccagctgcctctcccggccc
tgcgtggcccccagctgccaaaacatccccctgcctggggcctgcaacatccccgccaat
gtgggcaactgtggctggttctgcgagggcaccttcaatggcagcgagaaggaggccatg
cagttcctgaatgaccggctggccagctacctggagaaggtgcgccagctggagcgggag
aacgcggagctggagagcctcatccaggagcggtgccagcagcaggagcccctgatgtgc
tccagctaccagtcctacttccggaccatcgaggagctccagcagaagatcctgtgcagc
aaggcagagaacgccaggctggtggtgcagattgacaacgccaagctggctgctgacgac
ttcagaaccaagtatgagacggagctgggcttgaggcagctggtggagtcagacataaac
agcctacgcaggatcctggacgagctgaccctgtgcaggtctgacctggaggcccaggtg
gagtccttgaaggaggagctgctctgcctcaagcagaatcacgagcaggaagtcaacacc
ctgcgctgccagattggagaccgcctcaacgtggaggtggacgccgcccccactgtggac
ctgaaccgcgtgctcaacgagaccaggtgtcagtacgaggccctggtggagaccaaccgc
agggacgtggaggaatggttcaccacccagacccaggagctgaacaagcaggtggtgtcc
agctcggagcagctgcagacctgccaggcggagatcatcgagctgagacgcacggtcaac
gccctggagatcgagctgcaggcccagcacaacctgaggaactctctggagaacacgctg
acggagacggaggcccgctacagctcccagctgtcccaggtgcagtgcatgatcaccaac
gtggagtcccagctggctgagatcaggagtgaccttgagcggcagaaccaggagtaccag
gtgctgctggacgtccgggcccggctggagtgcgagatcaacacgtaccggggcctgctg
gagagcgaggactgcaagctgccctgcaacccctgcgccacaaccaatgcctgtgacaag
cccatagggccctgcgtcaccaatccctgcggcccttgtggcccccgaacccgctgtggg
ccctgcagcactgttgggtgctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513874
Entry
107513874         CDS       T06036                                 

Definition
(RefSeq) keratin, type I cuticular Ha4
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513874
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513874
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513874
   04147 Exosome [BR:ray04147]
    107513874
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513874
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513874
  Exosomal proteins of other body fluids (saliva and urine)
   107513874
  Exosomal proteins of colorectal cancer cells
   107513874
  Exosomal proteins of melanoma cells
   107513874
SSDB
Motif
Pfam: Filament Lipoprotein_7 Lzipper-MIP1 ERM Uso1_p115_C DUF4677 TPR_MLP1_2 SKA1
Other DBs
NCBI-GeneID: 107513874
NCBI-ProteinID: XP_016006481
LinkDB
Position
Unknown
AA seq 388 aa
MSYNCCLSNFSCRSSCPSRPCVAPSCQNIPLPGACNIPANVGNCGWFCEGTFNGSEKEVM
QFLNDRLASYLEKVRQLERENAELESLIQERCQQQEPLMCSSYQSYFRTIEELQQKILCA
KSENARLVVQIDNAKLASDDFRTKYEMEHSSRQLVESDINSLRRILDELTLCRSDLEAQV
ESLKEELLCLKKNHEEEVNTLRCQIGDRLNVEVDAAPAVDLNRVLNETRCQYEALVETNR
RDVEEWFTTQTQELNKQVVSSSEQLQTCQAEIIELRRTVNALEIELQAQHNLRNSLENTL
TETEARYSSQLSQVQCMITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRNLL
ESGDCNLPCNPCATTNACGNSCGPCGSS
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgtcttacaactgctgcctgtccaacttcagctgccgctccagctgcccctcccggccc
tgcgtggcccccagctgccaaaacatccccctgcctggggcctgcaacatccctgccaac
gtgggcaactgtggctggttctgcgagggcaccttcaatggcagcgagaaggaggtcatg
cagttcctgaatgaccggctggccagctacctggagaaggtgcgccagctggagcgggag
aacgcggagctggagagcctcatccaggagcggtgccagcagcaggagcccctgatgtgc
tccagctaccagtcctacttccggaccatcgaggagctccagcagaagattctgtgtgcc
aagtctgagaatgcccggctggtggtgcagatcgataatgccaagctggcctctgatgac
ttcagaaccaagtacgagatggagcattcctcaaggcagctggtggagtcagacataaac
agcctgcgcaggatcctggacgagctgaccctgtgcaggtctgacctggaggcccaggtg
gagtccttgaaggaagagctgctctgcctcaagaagaaccatgaggaggaagtcaacacc
ctgcgctgccagattggagaccgcctcaacgtggaggtggacgccgcccccgccgtggac
ctgaaccgcgtgctcaatgagaccaggtgtcagtacgaggccctggtggagaccaaccgc
agggacgtggaggaatggttcaccacccagacccaggagctgaacaagcaggtggtgtcc
agctcggagcagctgcagacctgccaggcagagatcatcgagctgagacgcacggtcaac
gccctggagatcgagctgcaggcccagcacaacctgaggaactctctggagaacacgctg
acggagacggaggcccgctacagctcccagctgtcccaggtgcagtgcatgatcaccaac
gtggagtcccagctggctgagatcaggagtgaccttgagcggcagaaccaggagtaccag
gtgctgctggacgtccgggcccggctggagtgtgagatcaacacgtaccggaaccttctg
gagagtggggactgcaacctgccctgcaacccatgtgctacaaccaatgcttgtggaaac
tcctgtgggccctgtggcagctcctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513875
Entry
107513875         CDS       T06036                                 

Definition
(RefSeq) keratin, type I cuticular Ha1
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513875
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513875
   04147 Exosome [BR:ray04147]
    107513875
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513875
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513875
  Exosomal proteins of other body fluids (saliva and urine)
   107513875
  Exosomal proteins of colorectal cancer cells
   107513875
  Exosomal proteins of melanoma cells
   107513875
SSDB
Motif
Pfam: Filament Lzipper-MIP1 TPR_MLP1_2 Lipoprotein_7 DUF4677 Baculo_PEP_C Uso1_p115_C FliD_C
Other DBs
NCBI-GeneID: 107513875
NCBI-ProteinID: XP_016006482
LinkDB
Position
Unknown
AA seq 422 aa
MPYNCCLPNLSCRSSCPSRPCVAPSCQNIPLPGACNIPANVGNCGWFCEGSFNGSEKETM
QFLNDRLASYLEKVRQLERENAELESRIQERCQQQEPLVCPSYQSYFRTIEELQQKILCT
KSENARLVVQIDNAKLAADDFRTKYETELGLRQLVESDMNGLRRILDELTLCKSDLEAQV
ESLKEELLCLKSNHEQEVNTLRCQIGDRLNVEVDAAPTVDLNRVLNETRCQYEALVETNR
RDVEEWFTTQTQELNKQVVSSSEQLQTCQAEIIELRRTVNALEIELQAQHNLRDSLENTL
TETEARYSSQLSQVQCMITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRDLL
ESEDCKLPCNPCATTNACGKPIGPCVSNPCVPCVPCTPCTPSASCTPCIPRSRCGPCISS
VR
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgccttacaactgctgcctgcccaatctgagctgtcgctccagctgcccctcccggccc
tgtgtggcccccagctgccaaaacatccccttgcctggggcctgcaacatccccgccaat
gtgggcaactgtggctggttctgtgagggttccttcaatggcagcgagaaggagaccatg
cagttcctgaatgaccggctggccagctacctggagaaggtgcgccagctggagcgggag
aacgcggagctggagagccgcatccaggagcggtgccagcagcaggagcccctggtgtgt
cccagctaccagtcctacttccggaccatcgaggagctccagcagaagatcctgtgcacc
aagtctgagaacgccaggctggtggtgcagattgacaacgccaagctggccgcggatgac
ttcagaaccaagtatgaaacagagctgggcttgcggcagctggtagagtcggacatgaat
ggcctgcgcaggatcctggacgagctgaccctgtgcaagtccgacctggaggcccaggtg
gagtccttgaaggaggagctgctctgcctcaagagcaaccatgaacaggaagtcaacact
ctgcgctgccagattggagaccgcctcaacgtggaggtggacgccgcccccactgtggac
ctgaaccgcgtgctcaacgagaccaggtgtcagtacgaggccctggtggagaccaaccgc
agggacgtggaggaatggttcaccacccagacccaggagctgaacaagcaggtggtgtcc
agctcggagcagctgcagacctgccaggcggagatcatcgagctgagacgcacggtcaac
gccctggagatcgagctgcaggcccagcacaacctgagggactctctggagaacacgctg
acggagacggaggcccgctacagctcccagctgtcccaggtgcagtgcatgatcaccaat
gtggagtcccagctggctgagatcaggagtgaccttgagcggcagaaccaggagtaccag
gtgctgctggatgtccgggcccggctggagtgtgagatcaacacgtaccgggacctgctg
gagagcgaggactgcaagctgccctgcaacccctgtgccacaaccaacgcgtgcggcaag
cccattgggccctgtgtctccaacccctgtgtcccctgtgtcccctgcaccccctgcact
ccctctgcctcctgcacgccttgcatcccccgctcccgctgtgggccctgtatctcctcc
gtgcgctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513876
Entry
107513876         CDS       T06036                                 

Gene name
KRT32
Definition
(RefSeq) keratin, type I cuticular Ha2
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513876 (KRT32)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513876 (KRT32)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513876 (KRT32)
   04147 Exosome [BR:ray04147]
    107513876 (KRT32)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513876 (KRT32)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513876 (KRT32)
  Exosomal proteins of other body fluids (saliva and urine)
   107513876 (KRT32)
  Exosomal proteins of colorectal cancer cells
   107513876 (KRT32)
  Exosomal proteins of melanoma cells
   107513876 (KRT32)
SSDB
Motif
Pfam: Filament Phage_GP20 Lzipper-MIP1 TPR_MLP1_2 Baculo_PEP_C DUF445
Other DBs
NCBI-GeneID: 107513876
NCBI-ProteinID: XP_016006483
LinkDB
Position
Unknown
AA seq 448 aa
MTSNCLPASVKSCPWPSSVCSSSMSCRPELCLGYVCQPMTCVPSVCMPTTYRPASCLSKT
YLASSCQPGSCRPTNSISSSMGTCNWYCEGTFSGSEKETMQVLNDRLANYLEKVRQLEQE
NASLESKIQEACQSQVPTIFPDYQSYFRTIEELQQKILCSKAENARMVVHIDNAKLAADD
FRTKYETELALRQLVEADTNGLRRILDELTLCKADLEAQVESLKEELLCLKQNHEQEVSA
LRCQLGDRLNIEVDAAPPVDLNRMLEEMRCQYETVVETNRRDVEAWFNMQMEELNQQVAT
SSEQLQTYQSDIIDLRRTVNTLEIELQAQHRLRDSLENTLTETEGRYGSQLAQMQCLISN
VEGQLAEIRCDLERQNREYQVLLDVRARLECEISTYRGLLESEDCKLPCNPCSTNSCPPC
VPSPSVPCTVCVPRTACVPCVPCPQARY
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgacatccaactgcttacctgcctccgtcaagagctgcccttggccttcttctgtctgc
tccagcagcatgagctgccggcctgagctgtgcctgggctatgtctgccaacccatgacc
tgcgtgccttctgtctgcatgcccaccacctaccggccggccagctgtctctccaagacc
tacctagccagctcctgccagcctggcagctgccggccaaccaatagcatctccagctcc
atgggtacctgcaactggtactgcgaagggaccttcagtggcagcgagaaggagaccatg
caggtcctgaatgaccggctggccaactacctggagaaggtgcgccagctggagcaggag
aacgccagcctggagagcaagatccaagaggcctgccagtcccaagtgcccaccatattt
cctgactaccagtcttatttcaggaccatcgaggagctccagcagaagattctgtgctcc
aaggcagagaacgctaggatggtggtgcacatcgacaatgccaagctggccgctgatgac
ttcaggaccaagtacgagacggagctggccctgcgccagctggtggaggccgacaccaac
ggcctgcgcaggatcctggacgagctgaccctgtgcaaggccgacctggaggcccaggtg
gagtctctgaaggaggagctgctctgcctcaagcagaaccatgagcaggaagtcagtgcc
ctccgatgccagcttggggaccgccttaacattgaggtggacgccgcgccccctgtggac
ctgaataggatgctggaagagatgcggtgtcagtatgagacagtggtggagaccaaccgt
agggacgtggaggcatggttcaacatgcagatggaggagcttaaccagcaggtggccacg
agctctgagcagctccagacctaccagtcagacatcattgatctgagacgaacagtcaac
acgctggagattgagctgcaggcccagcaccgcctgagggactctctggagaacacgctg
acggagacggagggccgctacggctcccagctggcccagatgcagtgcctgatcagcaac
gtggagggccagctggccgagatccgctgtgacctggaacggcagaaccgggagtaccag
gtgctgctggacgtccgggctcggctggagtgtgagatcagcacgtaccgaggcctgctg
gagagcgaggactgcaaattgccctgtaacccatgctccacaaactcatgtccgccttgc
gtgccctctcccagcgtgccctgcacagtctgtgtgccccgcactgcctgtgtaccttgt
gtgccctgcccccaagcccgctactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513877
Entry
107513877         CDS       T06036                                 

Gene name
KRT36
Definition
(RefSeq) keratin, type I cuticular Ha6
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513877 (KRT36)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513877 (KRT36)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513877 (KRT36)
   04147 Exosome [BR:ray04147]
    107513877 (KRT36)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513877 (KRT36)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513877 (KRT36)
  Exosomal proteins of other body fluids (saliva and urine)
   107513877 (KRT36)
  Exosomal proteins of colorectal cancer cells
   107513877 (KRT36)
  Exosomal proteins of melanoma cells
   107513877 (KRT36)
SSDB
Motif
Pfam: Filament ERM T6SS_VipA Lzipper-MIP1 Uso1_p115_C Phage_GP20 TPR_MLP1_2
Other DBs
NCBI-GeneID: 107513877
NCBI-ProteinID: XP_016006484
LinkDB
Position
Unknown
AA seq 461 aa
MATQVCSSVFSSGSVKGHCGTAGGISRVSSVRSVGSCRVPSLAGAAGSASSVRMGLSSLG
SCLPGSYLSAGCHPSGFIGSGGWSCEGSFNGSEKETMQFLNDRLANYLEKVRQLERENAE
LESRIRQWYESQIPYICPDYQSYFKTIEDLQQKVLLTKAENTRLVLQIDNAKLAADDFRT
KYEMELGLRQLVEADTNSLRRLLDELTLCRADLEAQVESLKEELLCLKKNHEEEVNALRC
QLGDRLNVEVDAAPPVDLNKILEDMRCQYEALVENNRRDVEAWFNTQTDELNQQVVSSSE
QLQCCQTEIIELRRTVNALEIELQAQHSMRNSLESTLAETEARYGSQLAQMQCLISNVEC
QLAEIRSDLERQNHEYQVLLDVKARLESEIATYRRLLEGEDCKLPAHPCATESKSSSRVP
CVSSMPCSSASQVGTQIRTITEEIRDGKVICSREHMQPCPL
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggccacccaggtctgctcctctgtcttctcttctggctccgtcaagggccactgtggc
acagcaggtggcatctctcgagtgtcttctgtccgctccgtgggctcctgcagggtcccc
agtcttgctggtgctgcagggtctgcctcctcggtcaggatgggcctctccagccttggg
agctgcttgcctggctcctacctgtctgctgggtgccacccctctggcttcattgggagc
gggggctggtcctgtgagggctccttcaatggcagcgagaaggagaccatgcagttcctg
aacgaccgcctggccaactacctggagaaggtgcgccagctggagcgggagaacgcggag
ctggagagccgcatccggcagtggtacgagtctcagatcccgtacatctgtccagactac
cagtcctacttcaagaccatcgaggatctccagcagaaggtcctgctgaccaaggctgag
aacaccaggctggtcctacaaatcgacaatgccaagctggctgccgatgacttccggacc
aagtatgagatggagctgggcttgcggcagctggtggaggccgacaccaacagcctgcgc
aggctcctggacgagctgaccctgtgcagggccgacctggaggcccaggtggagtctctg
aaggaggagctgctctgcctcaagaagaaccatgaagaggaagtcaacgcactccgttgc
caacttggggaccgactgaatgtggaggtggacgctgccccccctgtggatctcaacaag
attctggaagatatgcgatgccagtatgaggccctggtggagaacaaccgcagagacgtg
gaggcctggttcaacacccagaccgacgagctgaaccagcaggtggtgtccagctcggag
cagctgcagtgctgccagacggagatcatcgagctgagacgcacagtcaacgccctggag
atcgagctgcaggcccagcatagcatgcggaattctctggaatccaccctggcagagacg
gaggcccgctacggctctcagctcgcccagatgcagtgcctgatcagcaatgtggagtgc
cagctggccgagatccgctcggacctagagcggcagaaccacgagtaccaggtcctcctg
gacgtcaaggcccggctggagtcggaaatcgccacctaccgccgcctgctggaaggagaa
gactgcaagctgcctgcccacccttgtgccacagaaagcaagtcttccagtagagttcct
tgtgtctcgagcatgccctgctcctcggcttcccaggtcggcacccagatccgcaccatc
accgaggagatcagagatggaaaagtcatttgctccagggagcacatgcagccctgcccg
ctgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513878
Entry
107513878         CDS       T06036                                 

Gene name
KRT35
Definition
(RefSeq) keratin, type I cuticular Ha5
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513878 (KRT35)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513878 (KRT35)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513878 (KRT35)
   04147 Exosome [BR:ray04147]
    107513878 (KRT35)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513878 (KRT35)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513878 (KRT35)
  Exosomal proteins of other body fluids (saliva and urine)
   107513878 (KRT35)
  Exosomal proteins of colorectal cancer cells
   107513878 (KRT35)
  Exosomal proteins of melanoma cells
   107513878 (KRT35)
SSDB
Motif
Pfam: Filament Lzipper-MIP1 ADIP TPR_MLP1_2 T6SS_VipA PspA_IM30 DUF5082
Other DBs
NCBI-GeneID: 107513878
NCBI-ProteinID: XP_016006485
LinkDB
Position
Unknown
AA seq 455 aa
MASQCLRASFSSGSLKGPGGACGGSPRMSRMYSSSSCKLPSLSRGARSFSTCSAGLGRSS
YRAASCLPALCLPSGGFAISYSMGGGWFGEGILTGSEKETMQFLNDRLASYLEKVRQLEQ
ENASLESRIREWCEQQVPYLCPDYQSYFRTIEELQKKTLCTKAENARLVVQIDNAKLAAD
DFRTKYEVEVSMRQLVESDMNGLRRILDDLTLCKSDLEAQVESLKEELLCLKKNHEEEVN
SLRCQLGDRLNVEVDAAPPVDLNRVLDEMRCQYETLVENNRRDAEEWFNTQTEELNQQVV
SSSEQLQTCQAEIIELRRTVNALEIELQAQQSMRDALESTLAETEARYSSQLAQMQCLIS
NVESQLAEIRSDLERQNQEYQVLLDVRARLEGEISTYRGLLESEDCKLPCNPCAPDLAPS
KSCLPCVPVASCGPGTARTNCSPRPICVPCPGGRF
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggcttcccaatgcctcagggccagcttctcttcaggatctctcaagggtccgggagga
gcctgtgggggctcccctcgcatgtccagaatgtactccagcagctcttgtaagctcccg
agcctctcccgtggggcccgaagtttctctacatgctcagctgggctgggcaggagcagt
tacagggccgccagctgcctcccggctctctgcctcccgtctggaggctttgccatcagc
tatagcatgggagggggctggtttggggagggcatcctcactggaagcgagaaggagacc
atgcagttcctgaacgaccgcctggccagctacctggagaaggtgcgccagctggagcag
gagaacgccagcctggagagccgcatccgcgagtggtgtgagcagcaagtgccgtacttg
tgtccggactaccagtcctacttccggactattgaggagctccagaagaagaccctgtgc
accaaggcggagaacgccaggttggtggtgcagatcgacaatgccaagctggccgcagat
gatttcaggaccaaatatgaggtggaggtgtccatgaggcagctggtggagtcggacatg
aatggcctgcgcaggatcctggatgatctgaccttgtgcaagtccgacctggaggcccag
gtggagtctctgaaggaggagctgctctgcctcaaaaagaaccacgaggaggaagtgaac
tcactgcgctgccagcttggtgaccggctcaacgtcgaggtggatgctgccccacctgtc
gatctgaaccgtgttctggatgagatgaggtgccagtatgagactctggtcgaaaataac
cgtcgggacgctgaagaatggttcaacacccagaccgaggagctgaaccagcaggtggtg
tccagctcagagcagctgcagacctgccaggcggagatcatcgagctaagacgcacggtc
aacgccttggagatcgagctgcaggcccagcagagcatgagagatgctttggaatccacc
ctggctgagacagaggcccgctatagctcccagctggcccagatgcagtgcctgatcagc
aatgtggagtcccagctggctgagatcaggagtgaccttgagcggcagaaccaggagtac
caagtgctgttggatgtccgggcccggctggagggtgagatcagcacataccgaggcctg
ctggagagcgaggactgcaagctcccctgtaacccatgtgcccctgacctcgcgccttcc
aagtcatgcctcccctgtgttcctgtggcctcctgtggtcctggcacagcccgcacaaac
tgcagtccccgccccatttgtgtcccctgcccagggggccggttctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513879
Entry
107513879         CDS       T06036                                 

Definition
(RefSeq) keratin, type I cytoskeletal 14
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513879
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513879
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513879
   04147 Exosome [BR:ray04147]
    107513879
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513879
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513879
  Exosomal proteins of other body fluids (saliva and urine)
   107513879
  Exosomal proteins of colorectal cancer cells
   107513879
  Exosomal proteins of melanoma cells
   107513879
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Bacillus_HBL FlxA Lzipper-MIP1 DUF1664
Other DBs
NCBI-GeneID: 107513879
NCBI-ProteinID: XP_016006486
LinkDB
Position
Unknown
AA seq 474 aa
MTTCSRQFTSSSSMKGSCGIGGGSSRMSSVLAGGSCRAPSAYGGLSVSSSRYSSGGGYGL
GGGYGGGFSSSSSFGGGLGGGLGGGLGGGLGGGFGGGYGGGFGGGFGGGDGLVVGSEKVT
MQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPAETKDYSPYFKTIEDLRNKILT
ATVDNANVLLQIDNARLAADDFRTKYETELNLRMSVEADTNGLRRVLDELTLARADLEMQ
IESLKEELAYLRKNHEEEMNSMRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKIAEKN
RKDAEDWFFSKTEELNREVATNSELVQSSKSEISELRRTVQNLEIELQSQLSMKASLENS
LEETKGRYCMQLAQIQELIGGVEEQLAQLRCDMEQQNQEYKILLDVKTRLEQEIATYRRL
LEGEDAHLSSSHFSSGSQSSRDVTSSSRQIRTKVVDVHDGKVVSSHEQVLRAKN
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaccacctgcagccgccagtttacctcctccagctccatgaagggctcctgtggcatc
ggtggtggctccagccgcatgtcctctgttctggccggagggtcctgccgggcccccagt
gcctacgggggcctgtctgtctcctcctcccgctactcttctgggggtggctatgggctg
gggggcggctatggcggcggcttcagcagcagcagcagctttggtgggggcctgggtggt
ggccttggtggtggccttggtggtggcctcggtggtggctttggtggtggctatggtggt
ggctttggtggtggctttggcggtggcgatggactcgtggtgggcagtgagaaggtcacc
atgcagaacctcaacgaccgcctggcctcctacctggacaaggtgcgcgccctggaggag
gccaacgccgacctggaggtgaagatccgtgactggtaccagaggcagcggcctgctgag
accaaggactacagcccctacttcaagaccatcgaggacctgaggaacaagatcctcacg
gccactgtggacaatgctaatgtcctcctgcagattgacaatgcccgcctggccgcagat
gacttccgcaccaaatacgagacggagctgaacctgcgcatgagcgtggaggccgacacc
aacggcctgcgcagggtgctggacgagctgaccctggccagagccgacctggagatgcag
atcgagagcctgaaggaggagctggcttacctgaggaagaaccacgaggaggagatgaac
tccatgagaggccaggtgggcggagacgtcaacgtggagatggacgccgcccccggcgtg
gacctgagccgcatcctgaacgagatgcgcgaccagtacgagaagatagcggagaagaac
cgcaaggacgccgaggactggttcttcagcaagacagaggagctgaaccgcgaggtggcc
accaacagcgagctggtgcagagcagcaagagcgagatctccgagctccggcgcacggtg
cagaacctggagatcgagctgcagtcccagctcagcatgaaagcatccctggagaacagc
ttggaggagaccaaaggccgctactgcatgcagctggctcagatccaggagctgatcggc
ggcgtggaggagcagctggcccagctgcgctgcgatatggagcagcagaaccaggagtac
aagatcctgctggacgtgaagacgcggctggagcaggagatcgccacctaccgccgcctg
ctggagggcgaggatgcccacctctcctcctcccacttctcctctggctctcagtcgtcc
agagatgtgacctcctccagtcgtcagattcgcaccaaggttgtggacgtgcacgatggc
aaggtggtgtccagccacgagcaggtccttcgcgccaagaactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513880
Entry
107513880         CDS       T06036                                 

Gene name
KRT16
Definition
(RefSeq) keratin, type I cytoskeletal 16
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513880 (KRT16)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513880 (KRT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513880 (KRT16)
   04147 Exosome [BR:ray04147]
    107513880 (KRT16)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513880 (KRT16)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513880 (KRT16)
  Exosomal proteins of other body fluids (saliva and urine)
   107513880 (KRT16)
  Exosomal proteins of colorectal cancer cells
   107513880 (KRT16)
  Exosomal proteins of melanoma cells
   107513880 (KRT16)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 FlxA APG6_N ATG16
Other DBs
NCBI-GeneID: 107513880
NCBI-ProteinID: XP_016006487
LinkDB
Position
Unknown
AA seq 474 aa
MTTCSRQFTSSSSMKGSCGIGGGSSRMSSVLAGGSCRAPSAYGGLSVSTSRFSSGGACGL
GGGYGGGFSSSSSSFGGALGSGFGGGYGGGFGAGSGSGFGAGFGAGFGGYDGGLLSGNEK
VTMQNLNDRLASYLDKVRALEEANADLEVKIHDWYQKQRPSEVKDYSPYFKTIEDLRNKI
IAATIENAQPILQIDNARLAADDFRTKYEHELALRQSVEADINGLRRVLDELTLARADLE
MQIESLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQLAE
KNRKDAEAWFLSKTEELNREVASNSEQVQTSRSEVSELRRVLQGLEIELQSQLSMKASLE
SSLEETKGRYCMQLSQIQALISSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYR
RLLEGEDAHYSQNTSGHTYSSREVFSSSSSGHQTRPILKEQSSSSFSQGQTSKH
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaccacctgcagccgccagtttacctcctccagctccatgaagggctcctgtggcatc
ggtggtggctccagccgcatgtcctctgtcctggccggagggtcctgccgggcccccagt
gcctacgggggcctgtcagtctccacctcccgcttctcctccggaggagcctgtgggctg
gggggcggctatggcggtggcttcagcagcagcagcagcagctttggtggggctctgggt
agcggctttggcggaggatatggtggtggcttcggtgccggctccggcagtggctttggt
gctggcttcggtgctggcttcggcggttacgacggcggcctcctctctggcaatgagaag
gtgaccatgcagaacctcaacgaccgcctggcctcctacctggacaaggtgcgcgccctg
gaggaggccaacgccgacctggaggtgaagatccacgactggtaccagaagcagaggccc
agcgaggtcaaggactacagcccctacttcaagaccatcgaggacctgaggaacaagatc
attgcagccaccatcgagaacgctcagcctattctgcagattgacaatgccaggctggca
gccgatgacttcaggaccaagtatgagcatgagctggccctgcgccagagcgtggaggcc
gacatcaacggcctgcgcagggtgctggacgagctgaccctggccagagccgacctggag
atgcagatcgagagcctgaaggaggagctggcctacctgaggaagaaccacgaggaggag
atgctagccctgcggggtcagactggcggagacgtcaacgtggagatggacgctgcccct
ggagtggacctgagccgcatcctgaacgagatgcgcgaccagtatgagcagctggcagag
aagaaccgcaaggacgccgaggcctggttcctgagcaagaccgaggagctgaacagagaa
gtagcctctaacagcgaacaggtgcagactagccgcagcgaggtgtcggaactccggagg
gtgctccagggcctggagattgaattgcagtcccagctcagcatgaaagcatccctggag
agcagcctggaggagaccaaaggccggtactgcatgcagctgtcccagatccaggcgctg
atcagcagcgtggaggagcagctggcccagctgcgctgtgagatggagcagcagagccaa
gagtaccagatcctgctggacgtgaagacgcggctggagcaggagatcgccacctaccgc
cgcctgctggagggcgaggatgcccactactcccagaacacatccggacatacctattct
tcccgagaagtattctcctcctcatcctctggccaccagacccggcccatcctcaaggag
cagagctcgtccagcttcagccagggccagacctccaagcattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513882
Entry
107513882         CDS       T06036                                 

Gene name
KRT17
Definition
(RefSeq) keratin, type I cytoskeletal 17
  KO
K07604  type I keratin, acidic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
ray05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513882 (KRT17)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513882 (KRT17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513882 (KRT17)
   04147 Exosome [BR:ray04147]
    107513882 (KRT17)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     107513882 (KRT17)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107513882 (KRT17)
  Exosomal proteins of other body fluids (saliva and urine)
   107513882 (KRT17)
  Exosomal proteins of colorectal cancer cells
   107513882 (KRT17)
  Exosomal proteins of melanoma cells
   107513882 (KRT17)
SSDB
Motif
Pfam: Filament DUF2551 Bacillus_HBL DUF1664 RasGAP_C
Other DBs
NCBI-GeneID: 107513882
NCBI-ProteinID: XP_016006488
LinkDB
Position
Unknown
AA seq 433 aa
MTTTIRQFTSSSSIKGSSGLGGGSSRTSCRLSGSLGVGSCRLGSASGLGSALGGSSFSSC
YSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWY
QKQAPGPARDYSHYYQTIEDLKNKILTATVDNASILLQIDNARLAADDFRTKFETEQALR
VSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLRKNHEEEMSTLRGQVGGEINVE
MDAAPGVDLSRILNEMRDQYEKIAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEI
SELRRTVQALEIELQSQLSMKASLEGSLAETENRYCVQLSQIQGLIGSVEEQLGQLRCEM
EQQNQEYRILLDVKTRLEQEIATYRRLLEGEDAHLIQYKPKEPVTTRQVRTIVEEVQDGK
VISSREQVHQTTR
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaccaccaccatccgccagttcacttcctccagctccatcaagggttcatcgggcctt
gggggtggctcatcccgcacctcctgccgcctgtccgggagcctgggcgtgggctcctgc
aggctggggtccgccagcggcctaggcagtgccctcgggggcagcagcttttccagctgc
tacagctttggctctggtggtggctatggcagcagctttggaggtgttgacgggctgctg
gcaggaggtgagaaggccaccatgcagaacctcaacgaccgcctggcctcctacctggac
aaggtgcgtgccctggaggaggccaacacggagctggaggtgaagatccgcgactggtac
cagaagcaggcccccggccccgcccgcgactacagccactactaccagaccatcgaggac
ctgaagaacaagatcctcacggccaccgtggacaacgccagtatcctgctgcagatcgac
aatgcccgtttggctgctgatgacttccgcaccaagtttgagacagagcaggccctgcgt
gtgagcgtggaggccgacatcaacggcctgcgcagggtgctggacgagctgaccctggcc
agagccgacctggagatgcagatcgagaacctgaaagaagagctggcctacctgaggaag
aaccacgaggaggagatgagcaccctgcgaggccaggtgggcggtgagatcaacgtggag
atggacgccgcccccggcgtggacctgagccgcatcctgaacgagatgcgcgaccagtac
gagaagatagcggagaagaaccgcaaggatgccgaggactggttcttcagcaagacagag
gagctgaaccgcgaggtggccaccaacagcgagctggtgcagagcggcaagagcgagatc
tccgagctccggcgcacggtgcaggccttggagatcgagctgcagtcccagctcagcatg
aaagcatccctggaaggcagtctggcggagaccgagaaccgctactgcgtgcagctgtcc
cagatccaggggctgatcggcagcgtggaggagcagctgggccagctgcgctgtgagatg
gagcagcagaaccaggagtacaggatcctgctggacgtgaagacgcggctggagcaggag
atcgccacctaccgccgcctgctggagggcgaggatgcccacctgattcagtacaagccc
aaagaacctgtgaccacccgccaggtgcgcaccattgtggaagaggtccaggacggcaag
gtcatctcctcccgcgagcaggtccaccagaccacccgctaa

DBGET integrated database retrieval system