KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519971
Entry
107519971         CDS       T06036                                 

Gene name
CFTR
Definition
(RefSeq) cystic fibrosis transmembrane conductance regulator
  KO
K05031  cystic fibrosis transmembrane conductance regulator [EC:5.6.1.6]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray02010  ABC transporters
ray04024  cAMP signaling pathway
ray04152  AMPK signaling pathway
ray04530  Tight junction
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    107519971 (CFTR)
  09132 Signal transduction
   04024 cAMP signaling pathway
    107519971 (CFTR)
   04152 AMPK signaling pathway
    107519971 (CFTR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107519971 (CFTR)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    107519971 (CFTR)
   04972 Pancreatic secretion
    107519971 (CFTR)
   04976 Bile secretion
    107519971 (CFTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107519971 (CFTR)
Enzymes [BR:ray01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.6  channel-conductance-controlling ATPase
     107519971 (CFTR)
Transporters [BR:ray02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC7 subgroup
    107519971 (CFTR)
SSDB
Motif
Pfam: CFTR_R ABC_membrane ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase T2SSE AAA_16 DUF87 Zeta_toxin MMR_HSR1 MeaB NB-ARC AAA_30 NTPase_1 Intein_splicing
Other DBs
NCBI-GeneID: 107519971
NCBI-ProteinID: XP_016018748
LinkDB
Position
Unknown
AA seq 1491 aa
FIPEDLKWYQILSLYWRPNQVNISICSFYFSWTRPILRKGYRQRLELSDIYQIPSVDSAD
NLSEKLEREWDRELASKKNPKLINALRRCFFWKFMFYGVLLYLGEVTKAVQPLLLGRIIA
SYDPENKKERSIAIYLGIGLCLLFIMRTLLMHPAIFGLHHIGMQMRIAMFSLIYKKTLKL
SSRVLDKISIGQLVSLLSNNLNKFDEGLAVAHFVWIAPLQVTLLMGLIWDLLQASAFCGL
AFLIVLALFQAGLGRMMMKYRDQRAGKINERLVITSEIIENLQSVKAYCWEEAMEKMIEN
LRQTELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALNKGIILRKIFTTISFCIVLR
MAVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGE
LFENAKQNNNNRNISNGDNSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSL
LMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRNVIKACQLE
EDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIF
ESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMGY
ESFDHFSAERRSSILTDTLRRFSLEGDAAVPWNETKKQSFKQTGEFGEKRKNSILNSINS
IKKFSVVQKTPLQMNGIEEDSEEPPERRLSLVPDSEQGETILPRSNVINTGPTFQGRRRQ
SVLNLMTHSVNQGQIIHRKTAASTRKMSLAPQANLTEMDIYSRRLSQDSGLEISEEINEE
DLKECFFDDKENIPAVTTWNTYLRYVTIHKSLIFLLIWCLVIFLAEVAVSLVVLWLLRGT
PLQDKGNSTKSTNNSYAVIITSTSSYYVFYIYVGVADTLLVLGVFRGLPLVHTLITVSKI
LHHKMLHSVLHAPMSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLVLIVIGAVAV
VSVLQPYIFLATVPVIAAFILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRA
FGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEIIFVIFFIAVTFISILTTGEGEG
TVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSVSRVFKFIDMPAEESKSTKSIKPSKDGQ
LSKVTIIENQQDDIWPSGGQMTVKDLTAKYVDGGNAILENISFSLSPGQRVGLLGRTGSG
KSTLLSAFLRLLNTEGEIQIDGVSWNSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQ
WNDQEIWKVAEEVGLRSVIEQFPGKLDFVLVDGGFVLSHGHKQLMCLARSVLSKAKILLL
DEPSAHLDPITYQIFRRTLKQAFADCTVILSEHRIEAMLECQRFLVIEENKVRQYDSIQK
LLSEKSVFQQAISPLDRSKLFPHRNSSKHKSQSKITALKEETEEEVQDTRL
NT seq 4478 nt   +upstreamnt  +downstreamnt
tatttataccggaagatttgaaatggtatcagattttaagtctatattggagaccaaatc
aagtgaatatttctatctgttctttttattttagctggaccagaccaattttgagaaaag
ggtacagacagcgcctagagttgtcagacatataccaaatcccttcagttgattctgctg
acaatctctctgaaaaattggaaagagaatgggacagagagctggcatcaaagaaaaatc
ccaaactcattaatgctcttcggcgatgctttttctggaaatttatgttctatggagtct
tattatatttaggggaagtcaccaaagcagtccagcctctcttactgggaagaatcatag
cttcctatgatccagaaaacaagaaggaacgctccattgcaatttacctaggcataggct
tatgccttctctttatcatgaggacgctgctcatgcacccagccatttttggccttcatc
acattggaatgcaaatgaggatagctatgtttagtttgatttataagaagactttaaagt
tgtcaagccgtgttctagataaaataagtattggacaacttgttagtctcctttccaaca
acctgaacaaatttgatgaaggacttgcagtggcacatttcgtgtggatcgctcctttgc
aagtgacgctgctgatggggctgatctgggatttgttacaggcctccgccttctgtggac
ttgctttcctcatagtcctcgccctttttcaagctgggttagggagaatgatgatgaagt
acagagatcagagagctggaaagatcaatgaaagacttgtgattacctcagaaattattg
aaaatctccagtctgttaaggcatactgctgggaggaagcaatggaaaaaatgattgaaa
acctaagacaaacggaactgaaactgacccggaaggcagcctatgtgagatacttcaata
gttcagccttcttcttctcagggttctttgtggtgtttttatctgtgcttccctatgcac
tgaacaaaggaatcatccttcgaaaaatattcacaaccatctcattctgcatcgttttgc
gtatggcagttactcgtcagttcccctgggctgtacaaacgtggtatgactctctcggag
caataaataaaatacaggatttcttacaaaagcaagagtataagacattggaatataact
taacaactacagaagtagtgatggagaatgtaacagccttctgggaggaggggtttgggg
aattatttgagaatgcaaaacaaaacaataacaatagaaacatttccaatggtgataaca
gcctcttctttagtaacttctcacttcttggtactcctgtcctgaaagatatcaatttca
agatagaaagaggacagttgttggcagttgctggatccactggagcaggcaagacttcac
ttttgatgatgattatgggagaactggagccttcagagggtaaaattaaacacagtggaa
gaatttcattctgctctcagttttcatggataatgcctggcaccattaaagaaaacatta
tctttggtgtttcctatgatgagtatagatataggaatgtcatcaaagcatgccaactag
aagaagacatttccaagtttgccgagaaagacaatatagttcttggagaaggtggaatca
cactgagtggagggcagcgagcaagaatttctttagcaagagcagtatacaaagatgctg
atttatatctattagactctccttttggatacctagatgttttaacagaaaaagaaattt
ttgaaagctgtgtctgtaaattgatggctaacaaaactaggattttggtcacttctaaaa
tggaacatttaaagaaagctgacaaaatattaattttacatgaaggtagcagctattttt
atgggacattttctgaattacaaaatctacggcctgacttcagctcgaagctcatgggat
atgaatcttttgaccactttagtgcagaaagaagaagttcaatcctaactgacactttgc
ggcgtttctcattagaaggagatgctgctgtcccctggaatgaaacaaaaaaacagtctt
ttaaacagactggagagtttggtgaaaaaaggaagaactctattctcaattcaatcaact
ctataaaaaaattttcagtggtacagaagactccattacaaatgaatggcattgaagaag
attctgaagagcctccggagagaaggctgtccttagttccagattctgagcaaggagaga
ccatcctgcctcgaagcaatgtgattaacactggccccacatttcaggggagaaggaggc
agtctgttctgaacctgatgacacactcagtgaaccaaggtcagatcattcaccgaaaga
cagcagcatccacaaggaaaatgtcactggcccctcaggcgaacttaactgaaatggata
tatattcaagacgattatctcaggatagtggcttggaaataagtgaagaaattaatgaag
aagacttaaaggagtgcttttttgatgacaaggagaacataccagcagtgactacatgga
atacataccttagatatgttactatccacaagagcttaatttttttgcttatttggtgct
tagttatttttctggctgaggtggcggtttctttggttgtgttgtggctacttagaggaa
cacctcttcaagacaaagggaatagcactaagagtacaaataacagctacgcagtgatca
tcaccagcaccagctcctattatgttttttacatttatgtaggagtagccgacactttac
tggtcctgggagtcttccgaggtttaccactggtgcatactctgatcacagtgtcgaaaa
ttttacaccacaagatgttacattctgttcttcatgcacctatgtcaactctcaacacat
tgaaagcaggtggaattcttaatagattttccaaagatatagcaattttggatgatctgc
tgcctcttaccatatttgacttcattcagttggtattaattgtgattggagctgtagcag
tggtctcggttttacagccctacatcttcctagcaacagtgccagtgattgctgctttta
tcctattgagaggctacttcctccacacctcccagcaactcaaacaactggaatctgaag
gcaggagtccaattttcactcatctggttacaagcttaaaaggactgtggacacttcgtg
cctttggacgtcagccttactttgaaactctgttccacaaagctctgaatttacatacag
ccaactggttcttgtacctgtcaacactgcgctggttccaaatgagaatcgaaataattt
ttgtcatcttcttcattgctgttaccttcatttccattttaacaacaggtgaaggagaag
gaacagttggtattattctaactttagccatgaatatcatgagtacattgcagtgggctg
taaattccagcatagatgtggatagcttgatgcgatctgtgagccgagtctttaagttta
ttgacatgccagctgaagaaagtaaatccaccaagtcaatcaaaccatccaaggatggcc
agctctctaaagttaccattattgagaatcaacaagatgacatctggccctcggggggtc
aaatgactgtcaaagacctcacagcaaaatatgtagatggtggaaatgccatattagaga
acatttcattctcattaagtcctggccagagggtgggcctcttgggaagaactggatcag
ggaagagtactttgttatcagcttttttgagactactgaacaccgaaggagaaatccaaa
tagatggcgtgtcttggaattcaataactttgcaacagtggcggaaagcctttggagtga
taccacagaaagtattcatcttttctggaacatttagaaaaaacttggatccctacgaac
agtggaatgaccaagaaatatggaaagtcgcagaagaggttggactcagatctgtgatag
agcaatttcctgggaagcttgattttgtccttgtggatgggggttttgtcctaagccatg
gccacaagcagctgatgtgcttggccagatctgttctcagtaaggcaaaaatcttactgc
tcgatgagcccagtgctcatttggatccaataacatatcaaatctttcgaagaactctaa
aacaagcattcgctgattgcacagtgatcctcagtgagcacaggatagaagcaatgttgg
aatgtcagcgatttttggtcatagaggagaacaaagtgcggcagtatgattccatccaga
agctgctgagcgagaagagcgtgttccagcaggccatcagccccttggaccggtcgaagc
tgttcccccaccggaactcaagcaaacacaagtctcaatccaaaatcactgctctgaagg
aggagacagaagaagaggtacaggacaccaggctttag

DBGET integrated database retrieval system