KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519993
Entry
107519993         CDS       T06036                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1 isoform X1
  KO
K02105  catenin beta 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04510  Focal adhesion
ray04520  Adherens junction
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04670  Leukocyte transendothelial migration
ray04916  Melanogenesis
ray04919  Thyroid hormone signaling pathway
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05100  Bacterial invasion of epithelial cells
ray05132  Salmonella infection
ray05160  Hepatitis C
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05210  Colorectal cancer
ray05213  Endometrial cancer
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107519993 (CTNNB1)
   04310 Wnt signaling pathway
    107519993 (CTNNB1)
   04390 Hippo signaling pathway
    107519993 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107519993 (CTNNB1)
   04520 Adherens junction
    107519993 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107519993 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107519993 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107519993 (CTNNB1)
   04916 Melanogenesis
    107519993 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519993 (CTNNB1)
   05205 Proteoglycans in cancer
    107519993 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107519993 (CTNNB1)
   05225 Hepatocellular carcinoma
    107519993 (CTNNB1)
   05226 Gastric cancer
    107519993 (CTNNB1)
   05216 Thyroid cancer
    107519993 (CTNNB1)
   05217 Basal cell carcinoma
    107519993 (CTNNB1)
   05215 Prostate cancer
    107519993 (CTNNB1)
   05213 Endometrial cancer
    107519993 (CTNNB1)
   05224 Breast cancer
    107519993 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107519993 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    107519993 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107519993 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107519993 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107519993 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107519993 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    107519993 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107519993 (CTNNB1)
   05163 Human cytomegalovirus infection
    107519993 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107519993 (CTNNB1)
   05165 Human papillomavirus infection
    107519993 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 107519993
NCBI-ProteinID: XP_016018787
LinkDB
Position
Unknown
AA seq 782 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHP
TNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLS
KKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPA
LVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTD
CLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVE
AGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTC
AAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAE
MAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQL
LVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLF
VQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVL
FRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSF
HSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDT
DL
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagatagaaaagca
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttccctgagtggaaaaggcaatcctgaggaggaagatgtggatactacc
cagcaagtcctgtacgagtgggaacagggattttctcagtccttcacccaagaacaagta
gctgatattgatggacagtatgcgatgactcgagctcagagggtacgagctgccatgttc
cctgagacattagatgagggtatgcagatcccatctacacagtttgatgctgcgcatccc
actaacgttcagcgtttggctgaaccatcacagatgctgaaacatgctgttgtaaatttg
attaactatcaagatgatgccgaactggccacacgtgcaatccctgagttgacaaaactg
ctaaatgatgaggaccaggtggtggtgaataaagcagcagttatggttcatcagctttct
aaaaaggaagcttccagacacgccatcatgcgttcccctcagatggtgtctgctattgta
cgtaccatgcagaatacaaatgatgtggaaacagctcgctgtactgctgggaccttgcac
aatctttcccatcatcgtgagggcttgctggccatctttaagtctggaggcattcctgcc
ctggtgaagatgcttggttcaccagtggattctgtattgttttacgccattacaactctt
cacaaccttttattgcatcaggagggagctaaaatggcagtgcgtttagctggcggactg
cagaaaatggtcgccttgctcaataaaacaaacgttaaattcttggctattacgacagac
tgccttcagattttagcttacggcaatcaagagagcaagctgatcattctggctagcggt
ggacctcaagctttagtaaatataatgaggacctacacttatgagaagctactgtggacc
acaagcagagtactgaaggtgctgtctgtctgctctagtaataagccggctatcgtagaa
gctggtggaatgcaggctttaggacttcacctgacagatccaagtcagcgccttgttcag
aactgtctttggactcttaggaatctttcagatgctgcaactaagcaggaagggatggaa
ggtcttcttggaacccttgttcagctgctgggctccgatgatatcaatgtggtcacttgt
gccgctggaattctctctaatctcacttgcaataattacaagaacaagatgatggtgtgc
caagtgggtggcatagaggccctcgtgcgtactgttcttcgtgcgggtgatagagaggac
atcactgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaggaagcagag
atggcccagaatgctgttcgccttcactatggactgccagttgtggtgaagctcctgcac
ccaccatcccattggcctctgataaaggctactgttggattgattcgaaatcttgccctt
tgtccggcaaatcatgcacctttgcgtgagcagggtgccattccacgcctagttcagtta
ctggttcgtgcacatcaggacacccagcgccgtacgtctatgggtggaacacagcagcag
tttgtggagggggtccgcatggaagaaatagttgaaggttgtaccggagcccttcacatc
ctagctcgtgacgttcacaaccgaatcgtcatcagaggactgaacaccattccattgttc
gtgcagctgctttattctcccattgaaaatatccaaagagtagctgcgggggtcctctgc
gagcttgctcaggacaaggaggctgcggaagctatcgaagctgagggagccacagcccct
ctgacagagttgcttcactccaggaacgagggcgtggcaacatatgcagctgctgttctg
ttccgaatgtctgaggacaagccacaggattataagaaacggctttcagtcgagctgacc
agttctctgttcagaacggagcccatggcttggaacgagactgctgatcttggacttgat
atcggtgcccagggagaaccccttggatatcgccaggatgatcccagctatcgttctttt
cactctggtggatatggccaggatgccttgggtatggaccccatgatggagcatgagatg
ggtggccaccaccctggtgctgactatccagtggacgggctgccagatctggggcatgcc
caggacctcatggacgggctgcctccaggtgacagcaatcagctggcctggtttgatact
gacctgtaa

DBGET integrated database retrieval system