KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521043
Entry
107521043         CDS       T06036                                 

Gene name
ABCB11
Definition
(RefSeq) bile salt export pump isoform X1
  KO
K05664  ATP-binding cassette, subfamily B (MDR/TAP), member 11
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray02010  ABC transporters
ray04976  Bile secretion
ray04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    107521043 (ABCB11)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107521043 (ABCB11)
   04979 Cholesterol metabolism
    107521043 (ABCB11)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107521043 (ABCB11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107521043 (ABCB11)
   04147 Exosome [BR:ray04147]
    107521043 (ABCB11)
Transporters [BR:ray02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB11 subgroup
    107521043 (ABCB11)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107521043 (ABCB11)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 RsgA_GTPase ABC_ATPase AAA_22 Zeta_toxin AAA_15 AAA_29 AAA_30 DUF87 Rad17 AAA_21
Other DBs
NCBI-GeneID: 107521043
NCBI-ProteinID: XP_016020897
LinkDB
Position
Unknown
AA seq 1327 aa
MSDSVILRSVKKFGEDNHCFESDGLYSNDKNSRLQNEKKGDSSLVGFFQLFRFSSTTDIW
LMSVGSLCAFLHGLAHPGVLLIFGTMTDVFIEYDTELQELQIPGNACVNNTIVWSNSSLN
QNVTSGKRCGLLDIESEMIKFASYYAGTAVAVLITGYIQICFWVIASARQIQKMRKFYFR
RIMRMDIGWFDCNSVGELNTRFSDDINKINDAIADQMAIFIQRMTTSICGFLLGFYQSWK
LTLVIISVSPLIAIGAAIIGLSVSKFTEHELKAYAKAGAVADEVISSIRTVAAFGGEKRE
VERYEKNLVFAQRWGIRKGIVMGFFTGFMWCLIFFCYGLAFWYGSKLVLDEGEYTAGTLV
QIFLSVIVGALNLGNASSCLEAFAAGRAAATSIFEIIDRKPIIDCMSEDGCKLDRIKGEI
EFHNVTFHYPSRPEVKILNNLSMVIKSGEMTAVVGSSGAGKSTALQLIQRFYDPSEGMVT
LDGHDIRSLNIQWLRAQIGIVEQEPVLFSTTIAENIRYGREDATMEDIVQAAKKANAYNF
IMDLPQQFDTLVGEGGGQMSGGQKQRVAIARALIRNSKILLLDMATSALDNESEAMVQEA
LSKIQHGHTIISVAHRLSTVRAADVIIGFEHGAAVERGTHEELLERKGVYFTLVTLQSQE
DQDLNEENIKGKGKDETEDAFFESKQTFSRGSYQASLRASIRQHSKSQLSYLLHEPPLAV
VDHKSTYEEDRKGKDIPVEEEIEPAPVRRILKFNAQEWPYMLVGAVGAAVNGAVTPLYAF
LFSQILGTFSLLDKEEQRSQIRDVCLLFVAMGCVSLCTQFLQGYTFAKSGELLTKRLRKF
GFRAILGQNIGWFDDIRNSPGALTTRLATDASQVQGAAGSQIGMMVYSFINITVAMIIAF
FFSWKLSLVIVCFLPFLALSGVVQTRMLTGFASQDKQALETAGQITNEAISNIRTIAGIG
KERQFIEAFERELKKSFKTAIRKANVYGFCFGFSQCIVFVANSASYRYGGYLIPNEGLHF
SYVFRVISSVVLSGTAFGRAYSYTPNYAKAKISAARFFQLLDRRPSISVYSSAGERWDNF
QGQIDFVDCKFTYPSRPDIQVLNGFSVSVSPGQTLAFVGSSGCGKSTSIQLLERFYDPDQ
GKVMIDGHDSKKINVEFLRSNIGIVSQEPVLFACSIMDNIKYGDNTKEIPMEKVIEAAKQ
AQLHDFVMSLPEKYDTNVGSQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESE
KTVQVALDKAREGRTCIIIAHRLSTIQNSNIIAVVSQGIVIEKGTHKELMAQKGAYYKLV
TTGAPVS
NT seq 3984 nt   +upstreamnt  +downstreamnt
atgtctgactcagtaattcttcgcagtgtgaagaaatttggagaggacaatcattgtttt
gagtcagatggattatatagtaatgataagaattcacggttacaaaatgagaagaaaggt
gatagcagcctagttggcttctttcaactgtttcggttttcttcgacaactgacatttgg
ctgatgtctgtgggaagtttatgtgcatttctccatggactagcccatccaggcgtgcta
ctcatttttggcaccatgacagatgtttttattgagtatgacactgaactacaagaactc
cagatcccgggaaacgcatgtgtgaataacaccatagtgtggtccaacagctccctcaac
cagaatgtgacaagtggaaagcgctgtgggttgctggacattgaaagtgaaatgatcaaa
tttgccagttactatgctggaactgctgttgctgtgcttatcacaggatatattcagata
tgcttttgggtaattgcctcagctcgtcaaatacagaaaatgagaaaattttactttagg
agaataatgagaatggacataggatggtttgactgcaattcagtgggagagctgaataca
agattttctgatgatattaataaaattaatgatgccattgccgaccaaatggccattttc
attcagcgcatgaccacaagcatctgtgggttcctgctgggattttaccagagttggaaa
ctgaccttggtcattatctctgtcagccctctcattgcgattggagcagccatcattggt
ctgagcgtgtccaagtttactgagcatgaattgaaagcctatgccaaagcaggggcagtg
gctgatgaagttatttcatccattcgaacagtggctgcttttggtggtgagaaaagagag
gttgaaaggtatgagaaaaatcttgtgtttgcgcagcgttggggaattagaaaagggata
gtgatgggattctttactggattcatgtggtgtctcatcttcttctgttatggactggcc
ttctggtatggctccaaacttgtcctggatgaaggagaatatacagcaggaacccttgtc
cagatcttcctcagcgtaatagtaggagctttaaatcttggcaatgcatcttcttgtttg
gaagcctttgccgctggtcgagcagcagccaccagtatttttgagataatagaccggaaa
cccataattgactgcatgtctgaagatggttgcaagttggatagaattaagggtgaaatt
gaatttcataatgtgaccttccactatccttccagaccagaggtaaagattttaaataac
ctcagcatggtcatcaaatcaggagaaatgacagctgtggtaggatccagtggagccggg
aaaagcacagctctgcagctcattcagcgattctacgaccccagtgaaggcatggtgact
ttggatggccatgacattcgctctcttaacattcagtggcttagagctcagattggtata
gtggagcaggagcctgttctgttctccaccaccattgctgagaatattcgctatggcaga
gaagatgcaacaatggaagatatagtccaagctgccaagaaagccaatgcctacaatttc
atcatggacctgccacagcaatttgacactcttgttggagaaggaggaggccagatgagt
ggtggtcagaaacagagggtagccattgctagagccctcatccgaaactccaagatcctg
cttttggacatggccacctcggcgctggataatgagagtgaagccatggtgcaagaggca
ttgagtaagattcagcatggtcatacgatcatttcagttgctcatcgcctatccacagtc
agagctgcagacgtcattattggttttgaacatggtgcagcagtggaaagaggcactcat
gaagaactgttggaaaggaaaggcgtttacttcactctagtgactttacaaagtcaagaa
gatcaagatcttaatgaagagaacataaagggcaagggaaaagatgaaactgaagatgcc
ttctttgagagtaaacagacctttagcagagggagctaccaggctagtttaagagcttcc
atccggcaacactccaagtctcagctttcttacctgctacatgaacctccattagctgtt
gtagatcataaatctacttatgaagaagacagaaagggaaaggacattcctgtggaagaa
gaaattgaacctgctccagttaggaggattctgaaattcaatgctcaggaatggccctac
atgctggtaggggctgtgggtgctgctgtcaatggagcagtcacacccctctatgccttt
ttattcagccagattcttgggaccttttcacttcttgataaagaagaacaaaggtcacag
atccgtgatgtgtgccttctctttgtagcaatgggctgtgtatccctttgcactcaattt
ctgcagggatacacttttgctaaatccggggaactcctcacaaaaaggctacgtaaattt
ggttttagagcaatattagggcaaaacattggctggtttgatgacatcagaaatagccct
ggagcactgacaacaaggcttgctacagatgcttcccaagttcaaggggctgctggctct
caaattggaatgatggtctattctttcattaacatcacggtggccatgatcattgccttc
ttttttagttggaagctaagcctggtcatagtgtgcttcctccctttcttggctttatca
ggagtcgtacagaccagaatgttgacaggatttgcctctcaagacaagcaggctctggag
actgcaggacagattacaaatgaagccatcagtaatatccgcactattgctggaattgga
aaggagaggcagtttattgaagcatttgagagggagctgaagaaatcattcaagacagcc
attcgaaaagcaaatgtttatggattctgctttggcttttcccagtgcatagtgtttgtt
gctaattctgcttcctacagatatggaggttacttaatacccaacgaggggctgcacttc
agctacgtgttcagggtgatctcttcagttgtactgagtgggacagcttttggaagagcc
tactcttacaccccaaattatgccaaagctaaaatatcagctgcacgcttttttcaactg
ttggaccgacgaccttcaatcagtgtatacagtagtgcaggtgaaagatgggacaacttc
cagggacagattgactttgtcgactgtaaatttacatatccttctcgacctgatatacaa
gttctgaatggtttctcagtgtctgttagtccaggacaaacattggcattcgttggaagc
agtggatgtggcaaaagtaccagtattcagctactagaacgtttctatgatcctgatcaa
ggaaaagtgatgatagatggacatgacagcaaaaagataaatgtcgagtttctccgctcg
aacattgggattgtttcccaggagccagtgctgtttgcctgtagcataatggacaatatc
aagtacggggacaacaccaaagaaattcccatggaaaaagtcatagaagccgcaaagcag
gctcagctgcatgactttgtcatgtcactccccgagaaatatgatactaacgttgggtcc
caagggtctcagctctctcgaggagagaaacagcgcattgctattgctcgggccatcgtt
cgtgatcctaaaatcttgctactagatgaagctacttctgccttagacacagaaagtgaa
aagacggtgcaggttgccttggacaaagccagagaaggtcggacctgcattatcattgcc
catcgtttgtccaccatccagaactcgaatatcattgcagttgtgtcacagggtatagtg
attgaaaaggggacccataaagaactgatggcccagaaaggagcctactacaaactagtc
accacaggagcccccgtcagttga

DBGET integrated database retrieval system