KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521072
Entry
107521072         CDS       T06036                                 

Gene name
PPP1R1A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 1A isoform X1
  KO
K08050  protein phosphatase 1 regulatory subunit 1A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04720  Long-term potentiation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107521072 (PPP1R1A)
  09156 Nervous system
   04720 Long-term potentiation
    107521072 (PPP1R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107521072 (PPP1R1A)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107521072 (PPP1R1A)
SSDB
Motif
Pfam: DARPP-32 RP-C_C
Other DBs
NCBI-GeneID: 107521072
NCBI-ProteinID: XP_016020959
LinkDB
Position
Unknown
AA seq 191 aa
MEPDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEVDEDRIPNPLL
KHGKAEEAGERAGTPTCALCPLQSTLAMSPRQRKKVTRTTPTMKELQMMVEHHLGQQQQG
EEPEGAAESTGTQETYTPGITDTEAESRLDTSGKAPKSAPKTQERSTEKSSTEEPSTRTA
PLDSQGANSAR
NT seq 576 nt   +upstreamnt  +downstreamnt
atggagccagacaacagtccccggaagatccagttcacggtcccgctgctagagccgcac
cttgacccggaggcggcggagcagattcggagacgccgccccacccctgccactctagtg
ctgaccagcgaccagtcatccccagaggtagatgaagatcggatccccaacccgcttctc
aagcatggcaaggcagaagaggcaggagagagggctggcacccccacatgtgctctgtgt
cccttgcagtctactttggccatgtctccacggcaacggaagaaggtgacgaggaccaca
cccacaatgaaagagctccagatgatggttgaacatcacctggggcaacagcagcaggga
gaggagcctgagggagccgctgagagcacagggacccaggagacctacacacccgggatc
acagacacagaagcggagtcaaggctggacacctctgggaaagcaccaaaatccgcccca
aaaactcaggagagaagcactgagaaatcaagcacagaagaaccctcaacccgtacagca
ccactggattcccagggagccaactcggctaggtga

DBGET integrated database retrieval system