KEGG   Rhodopirellula baltica: RB6610
Entry
RB6610            CDS       T00134                                 

Definition
(RefSeq) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
rba  Rhodopirellula baltica
Pathway
rba00620  Pyruvate metabolism
rba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RB6610
Enzymes [BR:rba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     RB6610
SSDB
Motif
Pfam: CUT
Other DBs
NCBI-GeneID: 1793720
NCBI-ProteinID: NP_867360
UniProt: Q7UQ00
LinkDB
Position
3511694..3515401
AA seq 1235 aa
MLSSSPPSLSLDPTFFVRLPSIVERFGRKVLRDQLRQSFSITKLGFADHIHVRTGEILMA
LLREPTELQRALSWDRMLAAAPEQRQRLQNYLSFQLALAGLMPPGEEDQERPDAAFPREM
LDSFRERNAILRQHQPPIDQRIEAFLASYFGDEVGDEPLKLPSRSLNLDRHGMARELSMP
LGGNKFENDQVKSYRCFNGVLNNPRADRRTTAGTFHVVEGGLSIPGDKRVVPKNVFVNLF
RAAMQPPAADMELPYTHNSPHPAESWVSLMLRPLVAPGVPGYSESKTMETRFFVPGNYVS
NLDFVESIFGNAGDPLIAACDAGLDAKHWSGHTGCVILATHLTQLTKKELGLPHYDDANE
RQRHDRMCWQDETERYNDGGAFKITCRNSDGVIVTLIADNYYGYCKKEVKTQLSYAANLM
GNAEEEHAGGAIAFASYSLGDEFQVNSRLYNGQTFADVAKRYSDFIDVQPEGYGIDRIHP
SVIYIPEDALATLRERCIRWTDSSGKEQSIPLSPDEIYIAPSGYKLQLEKHPSAPSWRLI
GTVGEGVFCHKPCTVSGGGKSEISKSLRDYMLYGPIFVKDHEIDFQLVDDIFSKDYGTRW
SNSYTGRTDYSERPSRKVLDPNRSLGSVIKLLTPSPEYNDDYNAWLKSIPEHVYALALII
KRFAGPGVGDDWRESFGVDIVNGSPGHELKIGSRPLVGTYLRVGLENSQWRTFKLRQDFI
ASSKVQREDDISVSIVVPAGSIGDVGSAVAEAPSYKFVENCEYRLFQRPDDAVHRGLDKQ
TESDLAAPGNFISNFEPLTSQQARDIIRDAIEFDKFTGPMEELLLTAAASEDGYVVSTAN
PRLVDGKPTKNPRYLQDRPDLASPRATYVAMRGIQLHRKLGTSDAVLTPVGAVLSGRRNN
PPDAEAGIRSLAVYSPLHYQELPELVMDYVCSLTGKSPSTTGAGSEGALTKGPFNALHPA
VDLNAVIVSMILTDLGGFSTPAGHVGPNLEVGHDISLLIPEVWCRMTAEERDPRRMIEDG
MLEKIEDFDHDGKRIPASRLGYRITDKFVRTYLARVFDNPSKVFPEPILRPEKQDEDSFA
DGVLQISEAQARVAQNYFGDSGYELACPPLRAALDIMVHGEHNGKTIDDPEVRQLFSRES
LLSSDWYRRRLDAKQQRDIAHWKSMQQRLQAFMDDPLNADATERLNMKAQYEYATQQRQL
AESGDYIASLQGTLGVDPMSPLPNDPVMLDRLASV
NT seq 3708 nt   +upstreamnt  +downstreamnt
ttgctaagctcctctccaccaagcctgtccttggatccaacgtttttcgtgagactgccg
tcaatcgtcgaacgctttggacgcaaggtgctccgcgatcaattgcgtcaaagcttttcg
atcacgaagcttggttttgccgaccacattcatgttcgaaccggagagatcctcatggca
ttgctgcgagaacccacagaacttcaacgcgctttgagctgggaccgcatgcttgcggcc
gctccggaacaacggcaacgcctgcaaaactatctctcgtttcaattggccttggctgga
ctgatgccccccggcgaagaggaccaagaacgtcccgacgctgctttccctcgcgaaatg
ctggacagttttcgtgagcgcaacgcgattttgcgtcagcaccaaccaccaattgatcaa
cgtattgaagctttcctcgcgtcctactttggtgacgaggtcggcgacgaaccgctgaag
cttccgagtcgttctttgaatttggaccgtcacggtatggctcgtgaattgagcatgcct
ttgggtggcaacaagttcgaaaacgatcaggtcaaatcgtaccgctgcttcaacggtgtc
ttgaacaatccgcgagccgaccgccgcaccacggcagggacgttccacgttgtcgaaggc
ggattgtcgatccccggtgataaacgagtcgttcccaagaatgtcttcgtaaaccttttc
cgtgccgccatgcagccacccgcggccgacatggaattgccgtacacccacaactcgcct
caccccgctgaatcgtgggtgtcgctgatgttgcgtccattggttgctcccggtgttccc
ggatacagtgaatcgaagacgatggaaacccgtttcttcgttccgggcaactatgtcagc
aacctggacttcgtcgaatccatctttggcaatgccggcgaccctttgatcgctgcgtgc
gacgccggactcgatgccaaacactggagtggacacaccggttgcgtgattctggcaacc
cacctgactcagttgaccaagaaagaactggggctgcctcactacgacgatgcaaacgaa
cgccagcggcacgaccggatgtgctggcaagacgaaacggaacgctacaacgacggcggt
gctttcaaaatcacctgtcggaacagcgatggtgtgatcgtgactttgatcgccgacaac
tattacggttattgcaagaaagaagtcaaaacccagctcagctacgcagccaacttgatg
ggcaacgcggaagaggagcatgccggtggtgcaatcgcatttgcttcgtactcgttaggc
gacgagttccaagtcaacagtcgcctctacaacggccaaacatttgccgatgtcgcgaaa
cgctacagcgatttcattgacgttcaaccggaaggatacggcatcgatcgcatccatccg
agtgtcatctacatcccagaagatgccctggcaacgcttcgcgaacgctgcattcgctgg
acggattcatccggtaaagagcaatcgattccactttcgcccgatgagatttacatcgct
ccgagtggttacaagcttcaactggaaaaacacccctcggcaccaagctggcgtttgatc
ggcaccgtcggcgaaggcgtcttctgtcacaaaccctgcacggtcagcggtggtggcaaa
agcgaaatcagcaagagtcttcgcgactacatgttgtacggaccgatctttgtcaaagac
cacgaaatcgatttccaactcgtcgatgacatcttctcgaaagattacgggacgcgttgg
tcgaattcatacacgggtcgcaccgactacagcgagcgtcccagccgcaaggtgctcgat
ccaaatcgatcgctcggtagcgtgatcaagttgctgaccccaagtcccgaatacaacgac
gactacaacgcttggttgaagagcattcctgagcacgtctacgctctcgctttgatcatc
aaacgtttcgccgggcctggcgtcggcgatgattggcgtgaatcgttcggcgtcgatatc
gtcaacggttcaccgggccacgaactgaaaattggaagccgcccgttggtcggaacttac
ttgcgtgtcggtctggaaaactcgcaatggcgaacgttcaaactgcggcaggacttcatc
gcatcatccaaggttcagcgcgaagacgatatctccgtcagcatcgtggttcctgcggga
agcattggcgatgtcggatccgccgtcgcggaagctcccagctacaagtttgttgagaac
tgcgaataccgtttgttccaacggcccgacgatgccgttcatcgcggactggacaaacaa
actgagtctgatctggctgcaccgggcaactttatcagcaacttcgaaccactcaccagc
caacaagctcgcgacatcattcgtgatgccatcgagttcgacaaattcaccggcccgatg
gaagagctgctgctcaccgcggcggcatccgaggatggctacgtcgtcagcaccgccaat
ccgcgtttggtcgatggcaagccaacgaagaaccctcgttacttgcaagaccgtcccgat
ttggcatcgccccgcgcgacctatgttgccatgcgaggcatccaattgcatcgcaaactg
ggtactagcgatgcggtcctgactcccgtcggcgcggtcctgtccggtcgtcgcaacaat
ccaccagacgccgaagccggcatccgttcattggcggtttactcgccacttcactatcag
gagcttcctgaactggtgatggattacgtttgctcactgaccggcaaaagccccagcacg
actggtgcgggtagcgaaggtgcactgaccaaaggtccgttcaacgctttgcaccctgcc
gtcgacctgaatgccgtgatcgtctcgatgatcttgaccgatctgggcggcttcagcaca
cccgccggtcacgttggtcccaacctggaagtcggccacgacatttctttgttgatacct
gaagtctggtgccgcatgacggccgaagaacgcgacccacgccgcatgatcgaagacggc
atgctggaaaaaatcgaagacttcgaccacgacggcaaaaggattcctgccagtcgactt
ggctatcgcatcacggacaaattcgttcgcacctacctggctcgtgtcttcgacaacccg
tccaaggtcttccccgaaccgattttgcgtcccgagaaacaggatgaagattcgtttgcc
gatggcgtgctgcaaatttccgaagcccaagctcgtgtcgctcagaactacttcggtgat
tcgggatacgagttggcgtgcccgccgctgcgtgcggcactggacatcatggtgcacggc
gaacacaacggcaaaacgatcgacgatcccgaagtgcgtcaactcttttcgcgagaatca
ctgctcagcagtgactggtatcgacgtcgtctggacgccaaacagcaacgcgatatcgct
cactggaaatcaatgcagcagcgattgcaagcgttcatggacgatccgctcaatgccgac
gcaacggaacggctgaacatgaaagcccagtacgaatatgcgacccaacaacgccaattg
gccgagtcgggagactatattgcatcgttgcagggaaccttgggcgtcgacccgatgtcg
ccattacccaacgaccctgtgatgctggaccggttggccagcgtctag

DBGET integrated database retrieval system