KEGG   Rhodothermaceae bacterium RA: AWN76_004210
Entry
AWN76_004210      CDS       T04780                                 

Definition
(GenBank) hypothetical protein
Organism
rbar  Rhodothermaceae bacterium RA
SSDB
Motif
Pfam: Pentapeptide_2 DUF4175
Other DBs
NCBI-ProteinID: ARA92449
UniProt: A0A1V0DBN6
LinkDB
Position
1016900..1020451
AA seq 1183 aa
MSEHTLSLLAAIRDRLRATIRRITLAELACGLLLTLGILAGVLCAAVAVEAGFWLDPTPR
TVLYYAVLGLAGGLLVYFGVIPLLRLLGVLPGPGEQAVARRIGQRYPEVADRLVNLLDLA
EGRRSEAPPELVDRAVRMLGEQVQSVPFEQVEDFQRVRRVGRLASLPVVGLLVFMLVTPG
RFFDAAGRLFSPGTAFERPAPFRLLVEPGSVELVKGEALEITARADGSDVPPEIELALNQ
VGEDLIEPIRLTADSTGTFRHTVVNVRASFRYRLDAGAVTTPWYEARVVERPLVRSLRVA
LTFPAYTRIPPQRLAPNAGDVTALPGTEVAVEVELGGPDVTEAFLRFDDGRLDTLTLDGT
TASGRFTLRRAGSYQILLRNAEGLENRDPITYTLTLLTDAYPSVVLLSPAPQTELSDALR
ADLRLRIHDDFGFSRLRLYYRLAESRFGTPQDTFSEVPLPLEDRTLLDQEMLHIWLLNES
TGLDLVPGDVVEYYVKVWDNDAVAGYKAAQSATHRLRLPSLAEQYRELDAAQDEAQQTME
ELLQETDQLRDQFQELRDELRRKQQSDWEDERQLEQVQQRQQQIEQRVEELSREMQRLSE
QMEENDLVSPETLELYRELQKTVEEINSPELQEALQRLQEAMQNLDLPQMQQSLQDFEFN
EEQYQQRLERALELFKRIRLQQNLEEAARRAEELARRQERLAEQTRQLREEQPQGEQNQG
EQNQDEQNQGEQNQGEQNQGEQNQGEQNQGEQNQGEQHQGEQNQDAERLAREQERSREEM
EELAEQLRDLLEQMEQMRNTPADEMEQLHEDARRLPRQMEQNAEQLRQNRLDQAQQGQQQ
MQQQLQQMQQRLQQMQQGMQGQMIQVNRAGLRRALDDILRLSQQQESLRGDVSRLASDSP
RLRTYAQRQVELSEGLTVVSDSLQRLAREIPQMSRQVQQQAGEALREMTSATEALAERTA
VRAAGHQKGSMMHLNELALLLSELLDQLMNMQQSGGSGSMSLQQMIQQLQQMAGQQQQLN
QQLQQLLNDMQGDRLTSDMQQRLQQMAAQQEALRRQLREMSRNPEARGKLLGDLNKIAEQ
MEETIQELQRNRASRQTVQRQQQILTRLLDAQRSIRERGRENRREGQRPEQDLFDRDSPP
AQTPAEQADQLRRALIRALESGYAPDYEELIKRYFELLQSTDQ
NT seq 3552 nt   +upstreamnt  +downstreamnt
atgagcgagcacacgctgagcctgctggctgccatccgagaccgcctccgggccaccatc
cgccgcatcaccctggccgagctggcctgcgggctgctgctgacgctgggcatcctggcc
ggcgtgctgtgcgccgccgtggccgtggaggcgggcttctggctggacccgacgccgcgc
acggtgctctactacgccgtgctgggcctcgccggcgggttgctcgtctacttcggcgtc
atccccctgctgcggctgctcggggtgctgccggggccgggcgagcaggccgtggcccgg
cgaatcgggcagcgctacccggaggtggccgaccgcctggtgaacctgctggacctggcc
gaaggccgccgcagcgaagccccgccggagctcgtcgaccgggccgtgcggatgctgggc
gagcaggtgcagtcggtccccttcgagcaggtggaagacttccagcgggtccggcgcgtc
ggcaggctggccagcctgccggtcgtcgggctgctcgtcttcatgctcgtcacgccgggc
cggttcttcgacgccgccgggcggctgttctcccccggcaccgccttcgaacgcccggcc
ccgttccggctgctggtcgaaccgggctccgtcgaactggtcaagggcgaggcgctggag
atcaccgcccgtgccgacggcagcgacgtgccgcccgagatcgaactggccctcaaccag
gtcggcgaggacctgatcgaacccatccgcctgacggccgactcgacgggcaccttccgc
cacacggtcgtcaacgtgcgtgcctcgttccgctaccgcctcgatgccggagcggtgaca
acgccctggtatgaggcgcgcgtggtcgagcggccgctcgtgcgcagcctgcgcgtggcg
ctgaccttcccggcctacacccgcatccccccgcaacgcctcgccccgaatgccggggac
gtcaccgccctgcccggcaccgaggtggccgtcgaggtcgaactcggtggcccggacgtg
accgaggccttcctgcgcttcgacgacggccgcctggatacgctcaccctcgacgggacg
acggcctcggggcgcttcacgctccgccgggccggatcctaccagatcttgctgcgcaac
gccgaaggcctcgaaaaccgcgaccccatcacctacaccctcaccctgctcacggacgcc
tatccgtccgtcgtcctcctctcccccgccccccagaccgaactcagcgacgcactccgc
gccgatctgcgcctgcgcatccacgacgacttcggcttctcccgcctccgcctctactac
cgcctcgccgaaagccgcttcggcaccccacaggacaccttctcggaggtgcccctcccg
ctggaggaccgcacgctgctggaccaggaaatgctccatatctggctgctcaacgagtcc
accgggctcgacctcgtgccgggcgacgtggtcgagtactacgtgaaggtgtgggacaac
gacgccgtggccggctacaaggcggcccagagcgcaacgcatcgcctgcgcctgccctcg
ctggccgagcagtaccgcgaactggacgccgcgcaggacgaggcgcagcagacgatggaa
gaactgctgcaggagaccgaccagctccgcgaccagtttcaggaactgcgcgacgaactg
cgccggaagcagcaatccgactgggaggatgagcgccagctggagcaggtgcaacaacgc
cagcaacagatcgaacagcgcgtcgaagagctgagccgggagatgcagcggctctccgag
cagatggaggagaacgacctggtcagcccggagacgctcgaactgtaccgggagctgcag
aagaccgtcgaggagatcaactcgccggagttgcaggaagccctccagcggctccaggaa
gccatgcagaacctcgacctgccgcagatgcaacagtcgctgcaggacttcgagttcaac
gaggagcagtaccagcagcggctggagcgggcgctggagttgttcaagcgcatccgcctg
caacagaacctggaggaagccgcccgccgcgccgaggagctggcccgccgccaggaacgc
ctcgccgaacagacccgccagctccgagaggaacagccgcagggcgagcagaaccagggc
gagcagaaccaggacgagcagaaccagggtgagcagaaccagggcgagcagaaccagggc
gagcagaaccagggcgagcagaaccagggtgagcagaaccagggtgagcagcaccagggc
gagcagaaccaggacgccgagcggctggcccgggagcaggagcgctcccgcgaggagatg
gaggagctggccgaacagctacgggacctgctggaacagatggagcagatgcgcaacacg
ccggcggacgagatggagcaactccacgaagacgcccggcggttgccccggcagatggag
cagaatgccgagcagcttcgccagaaccggctcgatcaggcgcagcagggccagcagcag
atgcagcagcagctccagcagatgcagcaacggctccagcagatgcagcagggcatgcag
gggcagatgatccaggtcaatcgggccggtctgcgccgggccctggacgacatcctccgc
ctctcccagcagcaggaaagcttgcgtggcgacgtgagccgcctcgcctcggacagcccc
cggctacggacctacgcccagcgccaggtcgagctcagcgaaggcctcacggtcgtcagc
gactcgctgcagcggctggcgcgggagatcccgcagatgagccgccaggtccagcagcag
gccggcgaggccctgcgcgagatgacctcggccacggaggccctggccgaacgcacggcc
gtccgcgccgccgggcatcagaaaggctccatgatgcacctcaacgaactggccctgttg
ctctccgagttgctcgatcagctcatgaacatgcagcagagcggcggcagcggctcgatg
tcgttgcagcagatgatccagcagctccagcagatggccgggcagcagcagcaactcaac
cagcagctccagcagctcctcaacgacatgcagggcgaccgcctcacgtcggacatgcag
cagcgcctgcagcagatggccgcccagcaggaagccctgcgccggcaactccgggagatg
agccgcaacccggaggcgcgcggcaagctgctgggggatctcaacaagatcgcggagcag
atggaggagacgatccaggagttgcaacgcaaccgtgccagccggcagaccgtccagcgc
cagcagcagatcctgacgcgcctgctcgacgcgcaacgctccatccgcgagcgcggccgc
gaaaaccgccgcgaaggccagcgccccgagcaggacctgttcgaccgcgacagcccaccg
gcgcagacgccggccgagcaggccgaccagctccgccgggccctcatccgggcgctggag
agcggctatgcccccgattacgaagagctcatcaaacgctacttcgaactcctgcagtcg
accgaccagtag

DBGET integrated database retrieval system