KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108514542
Entry
108514542         CDS       T04641                                 

Gene name
CDH1
Definition
(RefSeq) cadherin 1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04015  Rap1 signaling pathway
rbb04371  Apelin signaling pathway
rbb04390  Hippo signaling pathway
rbb04514  Cell adhesion molecules
rbb04520  Adherens junction
rbb05100  Bacterial invasion of epithelial cells
rbb05200  Pathways in cancer
rbb05213  Endometrial cancer
rbb05216  Thyroid cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108514542 (CDH1)
   04390 Hippo signaling pathway
    108514542 (CDH1)
   04371 Apelin signaling pathway
    108514542 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108514542 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108514542 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108514542 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    108514542 (CDH1)
   05216 Thyroid cancer
    108514542 (CDH1)
   05218 Melanoma
    108514542 (CDH1)
   05219 Bladder cancer
    108514542 (CDH1)
   05213 Endometrial cancer
    108514542 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    108514542 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108514542 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rbb04515]
    108514542 (CDH1)
   04090 CD molecules [BR:rbb04090]
    108514542 (CDH1)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    108514542 (CDH1)
Cell adhesion molecules [BR:rbb04515]
 Cadherins
  Major cadherins
   108514542 (CDH1)
CD molecules [BR:rbb04090]
 Proteins
  108514542 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 Cadherin_3 BACON_2 Phage_holin_5_2
Other DBs
NCBI-GeneID: 108514542
NCBI-ProteinID: XP_017706305
LinkDB
Position
Un
AA seq 883 aa
MGPWSRSLSALLLLLLQVSSWFCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVSFED
CTGRQRTAYFSLDTRFKVGPDGVITVKRPLQFHNPQIHFLVYAWDSTYRKFSTKVTLNTV
GHHSRPPPLHASVSGVQAELLTFPNSSPGLRRRKRDWVIPPISCPENEKXPISXNLVQIK
SNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRENIATYTLFSHAVSSNG
NAVEDPMEILITVTDQNDNKPVFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAA
IAYTILSQDPELPDKNMFTINKNTGVISVVTTGLDRESFPMYTLVVQAADLQGEGLSTTA
TAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNSPAWEAVYTILNDN
DGQFVVTTNPVTNDGILKTAKGLDFEAKQQYILHVAVTNVAPFEVSLTTSTATVTVDVLD
VNEAPIFVPPEKRVEVSEDFGVGQEITSYTAREPDTFMEQKITYRIWRDTANWLEINPDT
GAISTRAELDREDSEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRN
IFLCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIEYNDPTQESIILKPKIALE
VGDYKINLKLMDNQNKDQVTTLEVSVCDCEGATGVCKKAPLVEAGLQIPAILGILGGILA
LLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDAR
PEVTRNDVAPTLLSVPRYLPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSG
SEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgggcccttggagccgcagcctgtcggcgctgctgctgctgctgctgcaggtctcgtct
tggttctgccaggagccggagccttgccaccccggctttgacgccgagagctacacgttc
acggtgccccggcggcacctggagagaggacgcgtcctgggcagagtgagttttgaagat
tgcaccggtcgacaaaggacagcctatttttccctcgacacccgattcaaagtgggccca
gacggtgtgattacagtcaaaaggcctctacagtttcataacccacagatccatttcttg
gtctacgcctgggactccacctacagaaagttttccaccaaagtcacgctgaatacagtg
gggcaccacagccgccccccgccccttcatgcctctgtttctggagtccaagcagaattg
ctcacatttcccaactcctctcctggactcagaagacggaagagagactgggttattcct
cctatcagctgtccagaaaatgaaaagnngcccatttcctaaaacctggttcagatcaaa
tccaacaaagataaagaaggcaaggttttctatagcatcactggccaaggagctgacaca
ccgcctgttggtgtctttattattgaaagagaaacaggatggctgaaagtgacagagcct
ctggatagagaaaacattgccacatacactctcttctctcatgctgtgtcatccaacggg
aatgcagttgaggacccaatggagattttgatcacggtgactgatcagaatgacaacaag
cccgtgttcacccaggaggtctttaaggggtctgtcatggaaggtgctcttccagggacc
tccgtaatggaggtcacagccacagacgcggacgacgatgtgaacacctacaatgccgcc
atcgcttacaccatcctcagccaagatcctgagctgcctgacaaaaatatgttcaccatt
aacaagaacacaggagtcatcagtgtggtcaccactgggctggaccgagagagtttccct
atgtataccctggtggttcaagctgctgaccttcaaggtgaggggttaagcacaacagca
acagctgtgatcacagtcactgacaccaatgataaccctccgatcttcaatcccaccacg
tacaagggtcaggtgcctgagaacgaggctaacgtcgtaatcaccacactgaaagtgact
gatgctgacgcccccaatagcccagcgtgggaggctgtatacactatattgaatgataat
gacggacaatttgttgtcaccacaaatccagtgaccaacgatggcattttgaaaacagca
aagggcttggattttgaggccaagcagcagtacattctacacgtggcagtgacgaacgtg
gcgccctttgaggtctccctcaccacctccacagccactgtcaccgtggatgtgctggat
gtgaacgaagcccccatctttgtgcctcctgaaaagagagtggaagtgtctgaggacttt
ggcgtgggccaggaaatcacatcctacaccgcccgggagccagacacatttatggaacag
aaaataacgtatcggatttggagagacactgccaactggctggagattaatccggacact
ggtgccatttccactcgggctgagctggacagggaggattctgagcacgtgaagaacagc
acgtacacagccctcatcatagctacagacaatggttctccagttgctactggaacaggg
actcttttgctgatcctgtctgatgtgaatgacaacgcccccataccagaacctcgaaat
atattcttgtgcgagaggaatccaaagcctcaggtcataaacatcattgatgcagacctt
cctcccaatacatctcccttcacagcagaactaacgcacggggcgagtgccaactggacc
attgagtacaacgacccaacccaagaatctatcattttgaagccaaagatagccttagag
gtgggtgactacaaaatcaatctcaagctcatggataaccagaataaagaccaagtgacc
accttagaggtcagcgtgtgtgactgtgaaggggccaccggcgtctgtaagaaggcacca
cttgttgaagcaggattgcaaattcctgccattctggggattcttggaggaattcttgct
ttgctaattctgattctgctgctcttgctgtttcttcggaggagagcggtggtcaaagag
cccttactgcccccagaggatgacacccgggacaacgtttattactatgatgaagaagga
ggtggagaagaggaccaggactttgacttgagccagttgcacaggggcctggacgctcgg
cctgaagtgactcgtaacgacgttgcaccaaccctcctgagtgtcccccggtaccttccc
cgccctgccaatcccgatgaaattggaaattttattgatgaaaatctgaaggcggctgat
agtgaccccacggccccgccttatgattctctgctcgtgtttgactatgaaggaagcggt
tccgaagctgctagtctgagctccctgaattcttcagagtcagacaaagaccaggactat
gattacttgaatgaatggggcaatcgcttcaagaagctggcagacatgtacggaggcggc
gaggatgactag

DBGET integrated database retrieval system