KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108516259
Entry
108516259         CDS       T04641                                 

Gene name
BAK1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb04141  Protein processing in endoplasmic reticulum
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05160  Hepatitis C
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05202  Transcriptional misregulation in cancer
rbb05203  Viral carcinogenesis
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05216  Thyroid cancer
rbb05217  Basal cell carcinoma
rbb05218  Melanoma
rbb05220  Chronic myeloid leukemia
rbb05222  Small cell lung cancer
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108516259 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108516259 (BAK1)
   04215 Apoptosis - multiple species
    108516259 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108516259 (BAK1)
   05202 Transcriptional misregulation in cancer
    108516259 (BAK1)
   05206 MicroRNAs in cancer
    108516259 (BAK1)
   05203 Viral carcinogenesis
    108516259 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108516259 (BAK1)
   05212 Pancreatic cancer
    108516259 (BAK1)
   05225 Hepatocellular carcinoma
    108516259 (BAK1)
   05226 Gastric cancer
    108516259 (BAK1)
   05214 Glioma
    108516259 (BAK1)
   05216 Thyroid cancer
    108516259 (BAK1)
   05220 Chronic myeloid leukemia
    108516259 (BAK1)
   05217 Basal cell carcinoma
    108516259 (BAK1)
   05218 Melanoma
    108516259 (BAK1)
   05213 Endometrial cancer
    108516259 (BAK1)
   05224 Breast cancer
    108516259 (BAK1)
   05222 Small cell lung cancer
    108516259 (BAK1)
   05223 Non-small cell lung cancer
    108516259 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    108516259 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108516259 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108516259 (BAK1)
   05160 Hepatitis C
    108516259 (BAK1)
   05164 Influenza A
    108516259 (BAK1)
   05162 Measles
    108516259 (BAK1)
   05168 Herpes simplex virus 1 infection
    108516259 (BAK1)
   05163 Human cytomegalovirus infection
    108516259 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108516259 (BAK1)
   05169 Epstein-Barr virus infection
    108516259 (BAK1)
   05165 Human papillomavirus infection
    108516259 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108516259 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rbb03029]
    108516259 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rbb02000]
    108516259 (BAK1)
Mitochondrial biogenesis [BR:rbb03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    108516259 (BAK1)
Transporters [BR:rbb02000]
 Other transporters
  Pores ion channels [TC:1]
   108516259 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 108516259
NCBI-ProteinID: XP_017709136
UniProt: A0A2K6MNK7
LinkDB
Position
Un
AA seq 211 aa
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcttcgggacaaggcccaggtcctcccaggcaggaatgcggagagcctgccctgccc
tctgcttctgaggagcaggtagcccgggacacagaggaggttttccgcagctacgttttt
taccgccatcagcaggaacaggaggctgaaggggcggctgcccctgccgacccagagatg
gtcaccttgcccctgcaacctagcagcaccatgggacaggtgggacggcagctcgccatc
atcggggacgacatcaaccgacgctatgactcagagttccagaccatgctgcagcacctg
cagcccacggcagagaacgcctatgagtacttcaccaagattgcctccagcctgtttgag
agtggcatcaactggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta
cacgtctaccagcgtggcctgactggcttcctgggccaggtgacccgcttcgtggtcgat
ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc
ctgaacttgggcaatggtcccatcctgaacgtgctggtggttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system