KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108517380
Entry
108517380         CDS       T04641                                 

Gene name
ATM
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01524  Platinum drug resistance
rbb03440  Homologous recombination
rbb04064  NF-kappa B signaling pathway
rbb04068  FoxO signaling pathway
rbb04110  Cell cycle
rbb04115  p53 signaling pathway
rbb04210  Apoptosis
rbb04218  Cellular senescence
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05202  Transcriptional misregulation in cancer
rbb05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    108517380 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108517380 (ATM)
   04068 FoxO signaling pathway
    108517380 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108517380 (ATM)
   04210 Apoptosis
    108517380 (ATM)
   04115 p53 signaling pathway
    108517380 (ATM)
   04218 Cellular senescence
    108517380 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108517380 (ATM)
   05206 MicroRNAs in cancer
    108517380 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108517380 (ATM)
   05170 Human immunodeficiency virus 1 infection
    108517380 (ATM)
   05165 Human papillomavirus infection
    108517380 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108517380 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108517380 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rbb03032]
    108517380 (ATM)
   03400 DNA repair and recombination proteins [BR:rbb03400]
    108517380 (ATM)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108517380 (ATM)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   108517380 (ATM)
DNA replication proteins [BR:rbb03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     108517380 (ATM)
DNA repair and recombination proteins [BR:rbb03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    108517380 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 108517380
NCBI-ProteinID: XP_017710759
LinkDB
Position
Un
AA seq 3060 aa
MSLALNDLLICCRQLEHDRATERKKEVEKFKRLIRDPETIIHLDRHSDSKQGKYLNWDAV
FRFLQRYIQKETECLRIAKPNVSASTQASRQKKMQEISSLVKYFIKCANRRAPRLKCQEL
LNYIMDTVKDSSSGAVYGADYSNILLKDILSVRKYWCEISQQQWLELFSVYFRLYLKPSQ
DVHRVLVARIIHAVTKGCCSQTDGLNSKFLDFFSKAIQCARQEKSSPGLNHILAALTIFL
KTLAVNFRIRVCELGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYIHHPKGAKTQEK
GAYESTKWKSILYNLYDLLVNEISHIGSRGKYSSGFRNIAVKENLIELMADICHQVQXVG
FNEDTRSLEISQSYTTTQRESSDYSVPCKRKKIELGWEVIKDHLQKSQNDFDLVPWLQIA
TQLISKYPASLPNCELSPLLMILSQLLPQQRHGERTPYVLRCLTEVALCQDKRSNLESSQ
KSDLLKLWNKIWCITFRGISSEQIQAENFGLLGAIIQSSLVEVDREFWKLFTGSACRPSC
PAVCCLTLALTTSIVPGTVKMGIEQNMCEVNRSFSLKESIMKWLLFYQLEGDLENSTEVP
PILHSNFPHLVLEKILVSLTMXNCKAAMNFFQSVPECDHHRKDKEELSFSEVEELFLQTT
FDKMDFLTIVRECGIEKHQSSIGFSVHQNLKESLDHYLLGLSEQLLNNYSSEITNSETLV
RCSSLLVGVLGCYCYMGVIAEEEAYKSELFQKAKSLMQCAGESITLFKNKTNEEFRIGSL
RNMMHLCTRCLSNCTKKSPNKIASGFFLRLLTSKLMNDIADICKSFASLIKKPFDRGEVE
SMEQDTNGNLMEVEEQSSMNLFNDYPDSSVSDANEPGESQSTIGAINPLAEEYLSKQDLL
FLDMLKFLCLCVTTAQTNTVSFRAADIRRKLLMLIDSSTLDPTKSLHLHMYLMLLKELPG
EEYPLPMEDVVELLKPLSNVCSLYRRDQDVCKTILNHVLHIVKNLGQSSMDSENTRDAQG
QFLTVIGAFWHLAKERKCTFSVRMALVNCLKTLLEADPYSQWAILNVMGKDFPVNEVFTQ
FLADNHHRVRMLAAESINRLFQDTKRDSSRLPKALPLRLQQTAFENAYLKAQEGMREMSH
SAENPEPLDEIYNRKSVLLMLIAVVLSCSPICEKQALFALCKSVKENGLEPHLVKKVLEK
VSETFGYRCLEDFMASHLDYLVLEWLNLQDTEYNLSSFPFILLNYTNIEDFYRSCYKVLV
PHLVIRSHFDEVKSIANQIQEDWKSLLTDCFPKILVNILPYFAYEGTGDSGMAQQRETAT
KVYDMLKSENLLGKQIDHLFISNLPEIVVELLMTLHEPANSSASQSTDLCDFSGDLDPAP
NPPHFPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKKH
RILKIYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHYINQRPSRIMDVSLRSFSLCCD
LLSQVCQTAVTYCKDALENHLHVIVGTLIPLVDEQVEIQKQVLDLLKYLVIDNKDNENLY
LTIKLLDPFPDHVVFKDLRITQQKIKYSRGPFSLLEEINHFLSVSVYDALPLTRLEGLKD
LRRQLELHKDQMMDIMRASQDNPQDGIMVKLVVNLLQLSKMAINHTGEKEVLEAVGSCLG
EVGPIDFSTIAIQHSKDASYTKALKLFEGKELQWTFIMLTYLNNTLVEDCVTVRSAAVTC
LKNILATKTGHSFWEIYKMTTDPMLAYLQPFRTSRKKFLEVPRFDKENPFEGLDDINLWM
PLSENHDIWIKTLTCAFLDSGGTKCEILQLLKPMCEVKTDFCQIVLPYLIHDILLQDTNE
SWRNLLSTHVQGFFTSCLRHFSQTSRSTTPANLDSESEHFFRCCLDKKSQRTMLAVVDYM
RRQKRPSSGTIFDDAFWLDLNYLEVAKVAQSCAAHFTALLYAEIYADKKSMDDQEKRSLA
FEEGSQSTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPITRLRTY
EHEAMWGKALVTYDLETAISSSTRQAGIIQALQNLGLCHILSVYLKGLDYENKDWCPELQ
ELHYQAAWRNMQWDHCTNVSKEIEGTSYHESLYSALQSLRDREFSAFYESLKYARVKEVE
ELCKRSLESVYSLYPTLSRLQAIGELESIGELFSKSVTHRQLSEVYIKWQKHSQLLKDSD
FSFQEPIMALRTVILEILMEKEIENSQRECIKEILTKHLVELSILSRTFKNTQLPERAIF
QIKQYNPVSCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCAANNPSLKLIYTE
CLRVCGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESNDELRNGKMKAFLSLARFSDT
QYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALK
EDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPSYKF
LPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPE
VARRSRITKNAPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDAT
QWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGV
NLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYK
VVPLSQRSGVLEWCTGTIPIGEFLVNNEDGAHKRYRPNDFSAFQCQKKMMEVQKKSFEDK
YEVFMDVCQNFQPVFRYFCMEKFLDPAIWFEKRLAYTRSVATSSIVGYILGLGDRHVQNI
LINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTME
VMRNSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRNLS
DIDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9183 nt   +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcaactagaacatgatagagct
acagaacgaaagaaagaagttgagaaatttaagcgcctgattcgagatcctgaaacaatt
atacatctagatcggcattcagattccaaacaaggaaaatacttgaattgggatgctgtt
tttaggtttttacagaggtatattcagaaagaaacagaatgtctgagaatagcaaaacca
aatgtatcagcctcaacacaagcctccaggcagaaaaagatgcaggaaatcagtagtttg
gtcaaatacttcatcaaatgtgcaaatagaagagcacctaggctaaaatgtcaagaactc
ttgaattatatcatggatacagtgaaagattcatctagtggtgctgtttacggagctgat
tatagcaacatactactcaaagacattctttctgtgagaaaatactggtgtgaaatatct
cagcaacagtggttagaattgttctctgtgtacttcaggctttatctgaaaccttcacaa
gatgttcatagagttttagtggctagaataattcatgctgttaccaaaggatgctgttct
cagactgatggattaaattccaaatttttggactttttttccaaggctattcagtgtgcg
agacaagaaaagagctctccaggtctaaatcatatcttagcagctcttactatcttcctc
aagactttggctgtcaactttcgaattcgagtgtgtgaattaggagatgaaattcttccc
actttgctttatatttggactcaacatagacttaatgattctttaaaagaagtcattatt
gaattatttcaactgcaaatttatatccatcatccaaaaggagccaaaacccaagaaaaa
ggtgcttatgaatcaacaaaatggaaaagtattttatacaacttatatgatctgctagtg
aatgagataagtcatataggaagtagaggaaagtattcttcaggatttcgtaatattgcc
gtcaaagaaaatttgattgaattgatggcagatatttgtcaccaggtacagtaagtaggt
tttaatgaagataccagatccttggagatttctcaatcttatactactacacaaagagaa
tctagtgattacagtgtaccttgtaaaaggaagaaaatagaactaggctgggaagtaata
aaagatcaccttcagaagtcccagaatgattttgatcttgtcccttggctacagattgca
acccaattaatatcaaagtatcctgcaagtttacctaactgtgagctgtctccattactg
atgatactatctcaacttctaccccaacagcgacatggggagcgtacaccatatgtgtta
cgatgccttacagaagttgcattgtgtcaagacaagaggtcaaacctagaaagctcacaa
aagtcagatttattaaaactctggaataaaatttggtgtattacctttcgtggtataagt
tctgagcaaatacaagctgaaaactttggcttacttggagccataattcagagtagttta
gttgaggttgacagagaattctggaagttatttactgggtcagcctgcagaccttcatgt
cctgcagtatgctgtttgactttggcactgaccaccagtatagttcctggaacagtaaaa
atgggaatagagcaaaatatgtgtgaagtaaatagaagcttttctttaaaggaatcaata
atgaaatggctcttattctatcagctagagggtgacttagaaaatagtacagaagtgcct
ccaattcttcacagtaattttcctcatcttgtactggagaaaattcttgtgagtctcact
atgnaaaactgtaaagctgcaatgaattttttccaaagtgtgccagaatgtgaccaccac
cgaaaagataaagaagaactttcattctcagaagtagaagaactatttcttcagacaact
tttgacaagatggactttttaaccatcgtgagagaatgtggtatagaaaagcaccagtcc
agtattggcttctctgtccaccagaatctcaaggaatcactggatcactatcttctggga
ttgtcagaacagcttctaaataattactcatctgagattacaaattcagaaacgcttgtc
cggtgttcaagtcttttggtgggtgtccttggctgctactgttatatgggtgtaatagct
gaagaggaagcatataagtcagaattattccagaaagccaagtctctaatgcaatgtgca
ggagaaagtatcactctgtttaaaaataagacaaatgaggaattcagaattggttccttg
agaaatatgatgcatctatgtacacgttgcttgagtaactgtaccaagaagagtccaaat
aagattgcatctggctttttcctgcgattgttaacatcaaagctaatgaatgacattgca
gatatttgtaaaagttttgcatccttaatcaaaaagccatttgaccgtggagaagtagaa
tcaatggaacaggatactaatgggaatctaatggaggtggaagagcagtcatccatgaat
ctatttaatgattaccctgatagtagtgttagtgatgcaaatgaacctggagagagccaa
agtaccataggtgccattaatcctttagctgaagaatatctgtcaaagcaagatctactc
ttcttagacatgctcaagttcttgtgtttgtgtgtaactactgctcagaccaatactgtg
tcctttagggcagctgatattcggaggaaattgttaatgttaattgattctagcacgcta
gaccctaccaaatccctccacctgcatatgtatctaatgcttttaaaggagcttcctgga
gaagaataccccttgccaatggaagatgttgttgaacttctgaaaccactatccaatgtg
tgttctttgtatcgtcgtgaccaagatgtttgtaaaactattttaaaccatgtccttcat
atagtgaaaaacctaggtcaaagcagtatggactctgagaacacaagggatgctcaagga
cagtttcttacagtaattggagcattttggcatctagcaaaggagaggaaatgtacattc
tctgtcagaatggccctagtaaactgccttaaaactttgcttgaggccgatccttattca
caatgggccattcttaatgtaatgggaaaagactttcctgtaaatgaagtatttacacaa
tttcttgctgataatcatcaccgagttcgcatgttggctgcagagtcaatcaatagattg
ttccaggacacgaagagagattcttccaggttaccgaaagcacttcctttgaggcttcag
caaacagcttttgaaaatgcatacttgaaagctcaggaaggaatgagagaaatgtcccat
agtgctgagaaccctgaacctttggatgaaatttataatagaaaatctgttttactgatg
ttgatagctgtggttttatcctgtagccctatctgtgaaaaacaggctttgtttgcccta
tgtaaatctgtgaaggagaatggattagaacctcaccttgtgaaaaaggttttagagaaa
gtttctgaaacctttggatatagatgtttagaagactttatggcatctcatttagattat
ctggttttggaatggctaaatcttcaagatactgaatacaacttatcttcttttcctttt
attttattaaactatacaaatattgaggatttctatagatcttgttataaggttttggtt
ccacatctggtgattagaagtcattttgatgaggtgaagtccattgctaatcagattcaa
gaggactggaaaagtcttctaacagactgctttccaaagattcttgtaaatattcttcct
tattttgcctatgagggtacaggagacagtgggatggcacagcaaagagagactgctacc
aaggtctatgatatgcttaaaagtgaaaacttactgggaaaacagatcgatcatttattc
attagtaacttaccagagattgtggtggagttattgatgacgttacatgagccagcaaat
tctagtgccagtcagagcactgacctctgtgacttttcaggggatttggatcctgctcct
aatccacctcattttccatcgcatgtgattaaagcaacatttgcctatatcagcaattgt
cataaaaccaagttaaagagcattttagaaattctttccaaaagccctgattcctatcag
aaaattcttcttgccatatgtgagcaagcagctgaaacaaataatgtttataagaagcac
agaattcttaaaatataccacttgtttgttagtttattactgaaagatataaaaagtggc
ttaggaggagcttgggcgtttgttcttcgagatgttatttatactctgattcactatatc
aaccaaaggccttctcgtatcatggatgtgtcattacgtagcttctccctttgttgtgac
ttattaagtcaggtttgccagacagcagtgacttactgtaaggatgctctagaaaaccat
cttcatgttattgttggtacacttataccccttgtggatgagcaggtggagattcagaaa
caggtattggacttgttgaaatacttagtgatagataacaaggataatgaaaacctctat
ctcacgattaagcttttagatccttttcctgaccatgttgtttttaaggatttgcgtatt
actcagcaaaaaatcaaatacagtagaggacccttttcactcttggaggaaattaaccat
tttctctcagtaagtgtttatgatgcacttccattgacaagacttgaaggactaaaggat
cttcgaagacaactggaactacataaagatcagatgatggacattatgagagcatctcag
gataatccacaagatgggattatggtgaagctagttgtcaatttgttgcagttatccaag
atggcaataaaccacactggtgaaaaagaagtgctagaggctgttggaagctgcttggga
gaagtgggtcctatagatttctctaccatagctatacaacatagtaaagatgcatcttat
accaaggcccttaagttatttgaaggtaaagaacttcagtggaccttcataatgctgacc
tacctgaataacacactggtagaagattgtgtcacagttcgatcagcagctgttacttgt
ttgaaaaacattttagccacaaagactggacatagtttctgggagatttataagatgaca
acagatccaatgctggcctatctacagccttttagaacatcgagaaaaaagtttttagaa
gtacccagatttgacaaagaaaacccttttgaaggcctggatgacataaatctgtggatg
cctctaagtgaaaatcatgacatttggataaagacactgacttgtgcttttttggacagt
ggaggcacaaaatgtgaaattcttcaattattaaagccaatgtgtgaagtgaaaactgac
ttttgtcagattgtacttccatacttgattcatgatattttgctccaagatacaaatgaa
tcatggagaaatctgctttctacacatgttcagggatttttcaccagctgtcttcgacac
ttctcacaaacgagccgatccacaacccctgcaaacttggattcagagtcagagcacttt
ttccgatgctgtttggataaaaaatcacaaagaacaatgcttgctgttgtggactacatg
agaagacaaaagagaccttcttcaggaacaatttttgatgatgctttctggctggattta
aattatctagaagttgccaaggtagctcagtcttgtgctgctcactttacagctttactc
tatgcagaaatctatgcagataagaaaagcatggatgatcaagagaaaagaagtcttgca
tttgaagaaggaagccaaagtacaactatttctagcttgagtgaaaaaagtaaagaagaa
actggaataagtttacaggatcttctcttagaaatctacagaagtataggagaaccagat
agtttgtatggctgtggtggagggaagatgttacaacccattactagactacgaacatat
gaacatgaagcaatgtggggcaaagccctagtaacatatgaccttgaaacagcaatctcc
tcatcaacccgccaggcgggaatcattcaggccttgcagaatttgggactctgccatatt
ctttctgtgtatttgaaaggattagattatgaaaataaagactggtgtcctgaactacag
gaactccattaccaagcagcatggaggaatatgcagtgggaccattgcaccaatgtcagc
aaagaaatagaaggaaccagttaccatgaatcattgtacagtgctctacaatctctaaga
gacagagaattctctgcattttatgaaagtctcaaatatgcaagagtaaaagaagtggaa
gagttgtgtaagcgcagccttgagtctgtgtattcgctctaccccacactcagcaggttg
caggccattggagagctggaaagcattggggagcttttctcaaaatcagtcacacataga
caactctctgaagtatatattaagtggcagaaacactcccagcttctcaaggacagtgat
tttagttttcaggagcctatcatggctctacgcacagtcattttggagatcctgatggaa
aaggaaatagagaactcacaaagagaatgtattaaggagattctcaccaaacaccttgta
gaactctctatactgtccagaactttcaagaacactcagctccctgaaagggcaatattt
caaattaaacagtataatccagttagctgtggagtctctgagtggcagctggaagaagca
caagtattctgggcaaaaaaggagcagagtcttgccctgagtattctcaagcaaatgatc
aagaagttggatgccagctgtgcagcgaacaatcccagcctaaaacttatatacacagaa
tgtctaagggtttgtggcaactggttagcagaaacttgcttagaaaatcctgcggtcatc
atgcagacctatctagaaaaggcagtagaagttgctggaaattatgatggagaaagtaat
gatgagctaagaaatggaaaaatgaaggcatttctgtcattagcccggttttcagatacg
caataccaaagaattgaaaactacatgaaatcatcagaatttgaaaacaagcaagctctc
ctgaaaagagccaaagaggaagtaggtctccttagggaacataaaattcagacaaacaga
tacacagtaaaggttcagcgagagctggagttggatgaacttgccctgcgtgcactgaaa
gaggatcgtaaacgcttcttatgtaaagcagttgaaaattacatcaactgcttattaagt
ggagaagaacatgatatgtgggtattccgactttgttccctctggcttgaaaattctgga
gtttctgaggtcaatggcatgatgaagagagatggaatgaagattccatcatataaattt
ttgcctcttatgtaccaactggctgctagaatggggaccaagatgatgggaggcctagga
tttcatgaagtcctcaataatctaatctctagaatttcaatggatcacccccatcatact
ttatttattatactggccttagcaaatgcaaacagagatgaatttctgactaaaccagag
gtagcaagaagaagtagaataactaaaaatgcgcctaaacaaagctctcagcttgatgag
gatcgaacagaagctgcaaacagaataatatgtactatcagaagtaggagacctcagatg
gtcagaagtgttgaggcactttgtgatgcttatattatattagcaaacttagatgccact
cagtggaagactcagagaaaaggcataaatattccagcagaccagccaattactaaactt
aagaatttagaagatgttgttgtccctactatggaaattaaggtggaccacacaggagaa
tatggaaatctcgtgactatacagtcatttaaagcagaatttcgcttagcaggaggtgta
aatttaccaaaaataatagattgtgtaggttctgatggcaaggagaggagacagcttgtt
aagggccgtgatgacctgagacaagatgctgtcatgcaacaggtcttccagatgtgtaat
acattactgcagagaaatactgaaactaggaagaggaaattaactatctgtacttacaag
gtggttcccctctctcagcgaagtggtgttcttgaatggtgtacaggaactatccctatt
ggtgaatttcttgttaacaatgaagacggtgctcataaaagatacaggccaaatgatttc
agtgcctttcaatgccaaaagaaaatgatggaggtgcaaaaaaagtcttttgaagataaa
tatgaagtcttcatggatgtttgccaaaattttcaaccagttttccgttacttctgcatg
gaaaaattcttggatccagctatttggtttgagaagcgattggcctatacgcgcagtgta
gccacttcttctattgttggttacatacttggacttggggatagacatgtacagaatatc
ttgataaatgagcagtcggcagaacttgtacatatagatttgggtgttgcttttgaacag
ggcaaaatccttcctactcctgagacagttccttttagactcaccagagatattgtggat
ggcatgggcattactggtgttgaaggtgtcttcagaagatgctgtgagaaaaccatggaa
gtgatgagaaactctcaggaaactctgttaaccattgtagaggtccttctgtatgatcca
ctctttgactggaccatgaatcctttgaaagctttgtatttacagcagaggccagaagat
gaaactgagcttcaccctactctgaatgcagatgaccaagaatgcaaacgaaatctcagt
gatattgaccagagtttcaacaaagtagctgaacgtgtcttaatgagactacaagagaaa
ctgaaaggagtggaagaaggcactgtgctcagtgttggtggacaagtgaatctgctcata
cagcaggccatggaccccaaaaatctcagccgacttttcccaggatggaaagcttgggtg
tga

DBGET integrated database retrieval system