KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108520941
Entry
108520941         CDS       T04641                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04630  JAK-STAT signaling pathway
rbb04640  Hematopoietic cell lineage
rbb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108520941 (IL3RA)
   04151 PI3K-Akt signaling pathway
    108520941 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108520941 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108520941 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108520941 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108520941 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rbb04050]
    108520941 (IL3RA)
   04090 CD molecules [BR:rbb04090]
    108520941 (IL3RA)
Cytokine receptors [BR:rbb04050]
 Interleukin receptor families
  IL3 receptor family
   108520941 (IL3RA)
CD molecules [BR:rbb04090]
 Proteins
  108520941 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind Gemini_mov Tissue_fac
Other DBs
NCBI-GeneID: 108520941
NCBI-ProteinID: XP_017716014
UniProt: A0A2K6LCY0
LinkDB
Position
Un
AA seq 327 aa
MVLLWLTLLLVATPCLLQTKEDRNPPIKNLRMKQKTQQLMWDLNRNVTDVECIKDSDDFM
PAMNNSYCQFGAISVCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFL
SCSWAVGPAAPADVQYDLYLNNLNSHEQHKCLHYNTDARGTRIGCRFDDIARLSSGSQRS
HILVRGRSAAFSIPCTDQFVVFSQIERLTPPHVTAECNKTHSFMQWKMRSHFNRKFRYEL
QIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDPEEGAS
SPAWRTSLPIALGTLLAVLCVFLICRR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggtcctcctttggcttacgctgctcctggtcgccacgccctgtctcctgcaaaccaag
gaggatcgaaacccaccaatcaagaacctaaggatgaaacaaaagactcagcagctgatg
tgggacctgaacagaaacgtgaccgacgtggagtgtatcaaagactccgacgactttatg
ccggccatgaacaatagctattgccagtttggagccatttccgtatgtgaagtgaccaac
tacaccgtccgagtggccagtcccccgttctccacgtggatcctcttccctgagaacagt
gggacacctcgggcaggcgcggagaatctgacctgctgggttcatgatgtggatttcttg
agctgcagctgggcggtaggcccggcggcccccgctgacgtccagtacgacctgtacttg
aacaatctcaacagccacgaacagcacaagtgtcttcactacaacacggatgctcgggga
acacggatcgggtgtcgtttcgatgacatcgctcgactctccagcggttctcaacgttcc
cacatcctggtgaggggcaggagcgcagccttcagtatcccctgcaccgatcagtttgtc
gtcttttcacagatcgagagattaactccaccccacgtgactgcagagtgtaataagaca
cattccttcatgcagtggaaaatgagaagtcatttcaatcgcaaatttcgctatgagctt
cagatccaaaagagaatgcagcctgtaagaacagaacaggtcagagacacaacctccttc
cagctacccaatcctggaacatacacagtgcaaataagagcccgggaaacagtgtatgaa
ttcttgagtgcctggagcaccccccagcgcttcgagtgcgacccggaggagggcgcgagc
tcgcctgcctggcggacgtcgctgccgatcgcgctggggacgctgctggccgtgctctgt
gtcttcctcatctgcagaaggtga

DBGET integrated database retrieval system