KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108522897
Entry
108522897         CDS       T04641                                 

Definition
(RefSeq) cytochrome b-245 heavy chain
  KO
K21421  NADPH oxidase 2 [EC:1.-.-.-]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04066  HIF-1 signaling pathway
rbb04145  Phagosome
rbb04216  Ferroptosis
rbb04217  Necroptosis
rbb04613  Neutrophil extracellular trap formation
rbb04621  NOD-like receptor signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05010  Alzheimer disease
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05140  Leishmaniasis
rbb05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108522897
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108522897
  09143 Cell growth and death
   04216 Ferroptosis
    108522897
   04217 Necroptosis
    108522897
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108522897
   04621 NOD-like receptor signaling pathway
    108522897
   04670 Leukocyte transendothelial migration
    108522897
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108522897
   05020 Prion disease
    108522897
   05022 Pathways of neurodegeneration - multiple diseases
    108522897
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108522897
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    108522897
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108522897
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108522897
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     108522897
Membrane trafficking [BR:rbb04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    108522897
SSDB
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 FAD_binding_6
Other DBs
NCBI-GeneID: 108522897
NCBI-ProteinID: XP_017718846
LinkDB
Position
Un
AA seq 502 aa
MLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLFNVE
WCVNARVGNSDRYSVALSELGDRQNESYLNFARDRIKNPEGGLYLAVTRVAGITGVVITL
CLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGVERIVRGQTAESLVKHRPEVC
EQKISEWGKIEDCPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHP
FKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEG
LFNACGCDKQEFQDAWKLPKXVKSTYYQHVXVQEKWHXIGQGQVRVTFLTNIIAVYQKYC
NNATNLRLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQA
NHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAKTLSK
QSISNSESGPRGVHFIFNKENF
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgctgattctcttgccagtctgtcgaaatctgctgtccttcctcaggggttccagtgcg
tgctgctcaacaagagttcgaagacaactggacaggaatctcacctttcataaaatggtg
gcatggatgattgcacttcactctgcgattcacaccattgcacatctatttaatgtggaa
tggtgtgtgaatgcccgagtcggcaattctgatcgttattcagtagcactctctgaactt
ggagacaggcaaaatgaaagttatctcaattttgctcgagatagaatcaagaaccctgaa
ggaggcctgtacctggctgtgacccgggtggcaggcatcactggagttgtcatcacgctg
tgcctcatattaattatcacttcctccaccaaaaccatccggaggtcctactttgaagtt
ttttggtacacacatcatctctttgtgatcttcttcattggccttgccatccatggagtt
gaacgaattgtacgtgggcagactgcagagagtttggttaagcatagaccagaagtttgt
gaacaaaaaatctcagaatggggaaaaatagaggactgcccaatccctcagtttgctgga
aaccctcctatgacttggaaatggatagtgggtcccatgtttctgtatctctgtgagagg
ttggtgcggttttggcgatctcaacagaaggtggtcatcaccaaggtggtcactcaccct
ttcaaaaccatcgagctacagatgaagaagaaggggttcaaaatggaagtgggacaatac
atttttgtcaagtgccccaaggtgtccaagctggagtggcaccctttcacactgacatct
gcccctgaggaagacttctttagtatccatatccgcatcgttggggactggacagagggg
ctgttcaatgcttgtggctgtgataagcaggagtttcaagatgcgtggaaactacctaag
tgagtaaaaagtacatattaccaacatgtatgagttcaggaaaaatggcattaaataggt
caaggccaagttagagtaactttcctaacaaatataatagcagtgtatcaaaaatattgc
aataacgccaccaatctgaggctcaaaaagatctacttctactggctgtgccgggacaca
catgcctttgagtggtttgcagacctgctgcaactgctggagagccagatgcaggaaagg
aacaatgccggcttcctcagctacaacatctacctcactggctgggatgagtctcaggcc
aatcactttgctgtgcaccatgatgaggagaaagatgtgatcacaggcctgaaacaaaag
actttgtatggacgacccaactgggataatgaattcaagacaattgcgagtcaacaccct
aataccagaataggagttttcctctgtggacctgaagccttggctaaaaccctcagtaaa
cagagcatctccaactctgagtctggccctcggggagtgcatttcattttcaacaaggaa
aacttctaa

DBGET integrated database retrieval system