KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108526989
Entry
108526989         CDS       T04641                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04144  Endocytosis
rbb04150  mTOR signaling pathway
rbb04270  Vascular smooth muscle contraction
rbb04310  Wnt signaling pathway
rbb04350  TGF-beta signaling pathway
rbb04360  Axon guidance
rbb04510  Focal adhesion
rbb04520  Adherens junction
rbb04530  Tight junction
rbb04611  Platelet activation
rbb04621  NOD-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04660  T cell receptor signaling pathway
rbb04670  Leukocyte transendothelial migration
rbb04722  Neurotrophin signaling pathway
rbb04810  Regulation of actin cytoskeleton
rbb04921  Oxytocin signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04972  Pancreatic secretion
rbb05100  Bacterial invasion of epithelial cells
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05152  Tuberculosis
rbb05163  Human cytomegalovirus infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05210  Colorectal cancer
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108526989 (RHOA)
   04015 Rap1 signaling pathway
    108526989 (RHOA)
   04310 Wnt signaling pathway
    108526989 (RHOA)
   04350 TGF-beta signaling pathway
    108526989 (RHOA)
   04072 Phospholipase D signaling pathway
    108526989 (RHOA)
   04071 Sphingolipid signaling pathway
    108526989 (RHOA)
   04024 cAMP signaling pathway
    108526989 (RHOA)
   04022 cGMP-PKG signaling pathway
    108526989 (RHOA)
   04150 mTOR signaling pathway
    108526989 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108526989 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108526989 (RHOA)
   04520 Adherens junction
    108526989 (RHOA)
   04530 Tight junction
    108526989 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108526989 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108526989 (RHOA)
   04621 NOD-like receptor signaling pathway
    108526989 (RHOA)
   04625 C-type lectin receptor signaling pathway
    108526989 (RHOA)
   04660 T cell receptor signaling pathway
    108526989 (RHOA)
   04670 Leukocyte transendothelial migration
    108526989 (RHOA)
   04062 Chemokine signaling pathway
    108526989 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108526989 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    108526989 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108526989 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    108526989 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108526989 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    108526989 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108526989 (RHOA)
   05206 MicroRNAs in cancer
    108526989 (RHOA)
   05205 Proteoglycans in cancer
    108526989 (RHOA)
   05203 Viral carcinogenesis
    108526989 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108526989 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108526989 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108526989 (RHOA)
   05135 Yersinia infection
    108526989 (RHOA)
   05133 Pertussis
    108526989 (RHOA)
   05152 Tuberculosis
    108526989 (RHOA)
   05100 Bacterial invasion of epithelial cells
    108526989 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108526989 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108526989 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108526989 (RHOA)
   04031 GTP-binding proteins [BR:rbb04031]
    108526989 (RHOA)
Membrane trafficking [BR:rbb04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    108526989 (RHOA)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108526989 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   108526989 (RHOA)
  Exosomal proteins of colorectal cancer cells
   108526989 (RHOA)
  Exosomal proteins of bladder cancer cells
   108526989 (RHOA)
GTP-binding proteins [BR:rbb04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    108526989 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 108526989
NCBI-ProteinID: XP_017723570
LinkDB
Position
Un
AA seq 122 aa
MAAIRKKLVIVGDGACGKTCLLIVFNKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLGEWPCILMFVIACVTGWHLVSGHQVAEK
QT
NT seq 369 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactagtgattgttggtgatggagcctgtggaaagacgtgc
ttgctcatagtgttcaacaaggaccagttcccagaggtgtatgtgcccacagtgtttgag
aactatgtggcagatatcgaggtggatggaaaacaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcctgaggcccctctcctacccagataccgatgttata
ctgatgtgtttttccatcgacagccctgatagtttaggtgagtggccctgcatcctgatg
tttgtcattgcctgtgtaactggttggcatctggtttctgggcatcaagtggctgaaaag
cagacatga

DBGET integrated database retrieval system