KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108532921
Entry
108532921         CDS       T04641                                 

Gene name
JUN
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04024  cAMP signaling pathway
rbb04137  Mitophagy - animal
rbb04210  Apoptosis
rbb04310  Wnt signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04530  Tight junction
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04668  TNF signaling pathway
rbb04722  Neurotrophin signaling pathway
rbb04912  GnRH signaling pathway
rbb04915  Estrogen signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05030  Cocaine addiction
rbb05031  Amphetamine addiction
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05161  Hepatitis B
rbb05162  Measles
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05224  Breast cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05321  Inflammatory bowel disease
rbb05323  Rheumatoid arthritis
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108532921 (JUN)
   04012 ErbB signaling pathway
    108532921 (JUN)
   04310 Wnt signaling pathway
    108532921 (JUN)
   04668 TNF signaling pathway
    108532921 (JUN)
   04024 cAMP signaling pathway
    108532921 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108532921 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    108532921 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108532921 (JUN)
   04530 Tight junction
    108532921 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108532921 (JUN)
   04621 NOD-like receptor signaling pathway
    108532921 (JUN)
   04625 C-type lectin receptor signaling pathway
    108532921 (JUN)
   04660 T cell receptor signaling pathway
    108532921 (JUN)
   04658 Th1 and Th2 cell differentiation
    108532921 (JUN)
   04659 Th17 cell differentiation
    108532921 (JUN)
   04657 IL-17 signaling pathway
    108532921 (JUN)
   04662 B cell receptor signaling pathway
    108532921 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108532921 (JUN)
   04915 Estrogen signaling pathway
    108532921 (JUN)
   04921 Oxytocin signaling pathway
    108532921 (JUN)
   04926 Relaxin signaling pathway
    108532921 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108532921 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108532921 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108532921 (JUN)
   05203 Viral carcinogenesis
    108532921 (JUN)
   05231 Choline metabolism in cancer
    108532921 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108532921 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108532921 (JUN)
   05211 Renal cell carcinoma
    108532921 (JUN)
   05224 Breast cancer
    108532921 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108532921 (JUN)
   05321 Inflammatory bowel disease
    108532921 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    108532921 (JUN)
   05031 Amphetamine addiction
    108532921 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108532921 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108532921 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108532921 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108532921 (JUN)
   05135 Yersinia infection
    108532921 (JUN)
   05133 Pertussis
    108532921 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108532921 (JUN)
   05170 Human immunodeficiency virus 1 infection
    108532921 (JUN)
   05161 Hepatitis B
    108532921 (JUN)
   05171 Coronavirus disease - COVID-19
    108532921 (JUN)
   05162 Measles
    108532921 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108532921 (JUN)
   05169 Epstein-Barr virus infection
    108532921 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108532921 (JUN)
   05142 Chagas disease
    108532921 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108532921 (JUN)
Transcription factors [BR:rbb03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    108532921 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha TFIIA FlaC_arch NBP1 Jnk-SapK_ap_N DUF3450
Other DBs
NCBI-GeneID: 108532921
NCBI-ProteinID: XP_017732739
LinkDB
Position
Un
AA seq 334 aa
MTAKMETTFYDDALNASFLPSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASMHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctcccg
tccgagagcggagcttatggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcagcggcgcagccggtcagcggggcg
ggcatggtggctccagcggtagcctcggtggcagggggcagcggcagcggaggcttcagc
gccagcatgcacagcgagccgcccgtctacgccaacctcagcaacttcaacccaggcgcg
ctgagcagtggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagcagccgccgcagccgccgcaccacctgccccagcagatgcccgtg
cagcacccgcggctgcaagccctgaaggaggagcctcagacagtgcccgagatgcctggc
gagacgccgcccctgtcccccattgacatggagtcccaggagcggatcaaggcggagagg
aagcgcatgaggaaccgcattgctgcctccaagtgccgaaaaagaaagctggagagaatc
gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system