KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108537103Help
Entry
108537103         CDS       T04641                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00590  Arachidonic acid metabolism
rbb01100  Metabolic pathways
rbb04611  Platelet activation
rbb04726  Serotonergic synapse
rbb04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108537103 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108537103 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    108537103 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    108537103 (PTGS1)
Enzymes [BR:rbb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108537103 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 108537103
NCBI-ProteinID: XP_017739733
UniProt: A0A2K6LB83
LinkDB All DBs
Position
Un
AA seq 599 aa AA seqDB search
MSRSLLLRFLLLLLLLLQLPVLLADPAAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIRIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVRSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQSAGRIGGGRNMDHHVLHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEMGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgagccggagtctcttgctccggttcttgctgctcctgctcctgctgctgcagctcccg
gtcctgctcgcggacccggcggcgcccacgccagtgaatccctgttgttactatccatgc
cagcaccagggcatctgtgtccgcttcggccttgaccgctaccagtgtgactgcacccgc
acgggctattccggccccaactgcaccatccctggcctgtggacctggctccggaattca
ttgcggcccagcccctctttcacccactttctgctcacacacgggcgctggttctgggag
tttgtcaatgccaccttcatccgagagatgctcatgcgcctggtactcacagtgcgctcc
aaccttatccccagtccccccacctacaactcagcacatgactacatcagctgggagtct
ttctccaacgtgagctattacactcgtattctgccctctgtgcctaaagactgccccacg
cccatgggaaccaaagggaagaagcagttgccagatgcccagctcctggcccgccgcttc
ttgctcaggaggaagttcatacctgacccccaaggcacgaacctcatgtttgccttcttt
gcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcctggcttcacc
aaggccttgggccatggggtagacctcggtcacatttatggagacaatctggagcgtcag
tatcaactgcggctctttaaggatgggaaactcaagtaccaggtgctggacggagaaatg
tacccgccctcggtagaagaggcgcctgtgttgatgcactatccccgaggcatcccgccc
cagagccagatggcggtgggccaggaggtgtttgggctgcttcccgggctcatgctgtat
gccacgctctggctacgcgagcacaatcgtgtgtgtgacctgctgaaggctgagcacccc
acctggggtgatgagcagcttttccagacgacccgcctcatcctcataggggagaccatc
aggattgtcatcgaggagtatgtgcagcagctgagtggctacttcctgcagctaaagttt
gacccagagttgctgtttggtgtccagttccagtaccgcaatcgcattgccatggagttc
aaccatctctaccactggcaccccctcatgcctgactccttcaaggtgcgctcccaggag
tacagctacgagcagttcttgttcaacacctccatgttggtggactatggggtcgaggcc
ctggtggatgccttctctcgccagagcgctggccggatcggtgggggcaggaacatggac
caccacgtcctgcacgtggctgtggatgtcatcagggagtctcgggagatgcggctgcaa
ccctttaatgagtaccgcaagaggtttggcatgaagccctacacctccttccaggagctc
gtaggagagaaggagatggcagcggagttggaggagctgtatggagacattgatgcgttg
gagttctaccctgggctgcttcttgaaaagtgccatccaaactctatatttggggagagt
atgatagagattggggctcccttttccctcaagggtctcctagggaatcccatctgttct
ccggagtactggaagccgagcacatttggcggcgagatgggctttaacatcgtcaagacg
gccacactgaagaagctggtctgcctcaacaccaagacctgtccctacgtttccttccgt
gtgccggatgccagtcaggatgatgggcctgctgtggagcgaccatccacagagctctga

DBGET integrated database retrieval system