KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108541808
Entry
108541808         CDS       T04641                                 

Gene name
IL1A
Definition
(RefSeq) interleukin 1 alpha
  KO
K04383  interleukin 1 alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04217  Necroptosis
rbb04218  Cellular senescence
rbb04380  Osteoclast differentiation
rbb04640  Hematopoietic cell lineage
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04940  Type I diabetes mellitus
rbb05010  Alzheimer disease
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05133  Pertussis
rbb05140  Leishmaniasis
rbb05152  Tuberculosis
rbb05162  Measles
rbb05164  Influenza A
rbb05321  Inflammatory bowel disease
rbb05323  Rheumatoid arthritis
rbb05332  Graft-versus-host disease
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108541808 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108541808 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108541808 (IL1A)
   04218 Cellular senescence
    108541808 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108541808 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108541808 (IL1A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    108541808 (IL1A)
   05321 Inflammatory bowel disease
    108541808 (IL1A)
   05332 Graft-versus-host disease
    108541808 (IL1A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108541808 (IL1A)
   05020 Prion disease
    108541808 (IL1A)
   05022 Pathways of neurodegeneration - multiple diseases
    108541808 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108541808 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108541808 (IL1A)
   04932 Non-alcoholic fatty liver disease
    108541808 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108541808 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108541808 (IL1A)
   05152 Tuberculosis
    108541808 (IL1A)
  09172 Infectious disease: viral
   05164 Influenza A
    108541808 (IL1A)
   05162 Measles
    108541808 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108541808 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108541808 (IL1A)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Interleukins
   108541808 (IL1A)
SSDB
Motif
Pfam: IL1 IL1_propep
Other DBs
NCBI-GeneID: 108541808
NCBI-ProteinID: XP_017746972
UniProt: A0A2K6MJJ0
LinkDB
Position
Un
AA seq 271 aa
MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYDVSYDPLHEGCMDQCVSLSISEIS
KTSKLTFKQSMVVVATNGKVLKKRRLSLSQSITDDDLKAITSDSEEEIIKPRSAPFSFRS
NMKYNFIRIIKHEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYTSSKDDTKV
PVILRISETQLYVSAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP
NLFIATKQDYWVCLARGPPSITDFQILENQA
NT seq 816 nt   +upstreamnt  +downstreamnt
atggccaaagttccggacatgtttgaagacctgaagaactgttacagtgaaaacgaagaa
gacagttcctccattgaccatctgtctctgaatcagaaatccttctatgatgtaagctat
gacccactccatgaaggctgcatggatcagtgtgtgtctctgagtatctctgaaatctct
aaaacatccaagcttaccttcaagcagagcatggtggtagtagcaaccaatgggaaggtt
ctgaagaagagacggttgagtttaagccaatccatcactgatgatgacctgaaggccatc
accagtgactcagaggaagaaatcatcaagcctaggtcagcaccttttagcttccgaagc
aatatgaaatacaactttataaggatcatcaaacacgaattcatcctgaatgacgccctc
aatcaaagtataattcgagccaatgatcagtacctcacggctgctgcattacataatctg
gatgaagcagtgaaatttgacatgggtgcttatacgtcatcaaaggacgatactaaagtt
cctgtgattctaagaatctcagaaactcaattgtatgtgagtgcccaagatgaagaccaa
ccggtgctgctgaaggagatgcctgagatacccaaaaccatcacaggtagcgagaccaac
ctcctcttcttctgggaaactcacggcactaagaactacttcacatcagttgcccatcca
aacttgtttattgccacaaagcaagactattgggtgtgcttggcaagagggccaccctct
atcactgactttcagatactggaaaaccaggcttag

DBGET integrated database retrieval system