KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108542466
Entry
108542466         CDS       T04641                                 

Gene name
CASP7
Definition
(RefSeq) caspase 7
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04210  Apoptosis
rbb04215  Apoptosis - multiple species
rbb04668  TNF signaling pathway
rbb04932  Non-alcoholic fatty liver disease
rbb05010  Alzheimer disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05134  Legionellosis
rbb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    108542466 (CASP7)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108542466 (CASP7)
   04215 Apoptosis - multiple species
    108542466 (CASP7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108542466 (CASP7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108542466 (CASP7)
   05022 Pathways of neurodegeneration - multiple diseases
    108542466 (CASP7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108542466 (CASP7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108542466 (CASP7)
   05133 Pertussis
    108542466 (CASP7)
   05134 Legionellosis
    108542466 (CASP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rbb01002]
    108542466 (CASP7)
Enzymes [BR:rbb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     108542466 (CASP7)
Peptidases and inhibitors [BR:rbb01002]
 Cysteine peptidases
  Family C14: caspase family
   108542466 (CASP7)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 108542466
NCBI-ProteinID: XP_017747992
UniProt: A0A2K6MPJ1
LinkDB
Position
Un
AA seq 303 aa
MADDQGCVEEQGIGNSANEDSVDAKPDRSSFVPSLLSKKKKNVSEQSIKTTRDRVPTYQY
NMNFEKMGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVTVHNDCSCAKMQ
NLLKKASEEDHTNAACFACILLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESHSDDPRFHEKKQIPCVVSMLTKELY
FSH
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcagacgatcagggctgtgttgaagagcagggaattgggaattcagcaaatgaagat
tcagtggatgctaagccagaccggtcctcatttgtaccatccctcttgagtaagaagaag
aaaaatgtctcagagcaatccatcaagaccacccgggaccgagtgcctacatatcagtac
aacatgaattttgagaagatgggcaaatgcatcataataaacaacaagaacttcgataaa
gtgacaggtatgggcgttcgaaacggaacagacaaagatgccgaggcactctttaagtgc
ttccgaagtctgggttttgacgtgacagtccataatgactgctcttgtgcaaagatgcaa
aatctgcttaaaaaagcttctgaagaggaccatacaaatgccgcctgcttcgcctgcatc
ctcttaagccacggagaagaagatttaatttatgggaaagatggtgtcacaccaataaag
gatttgacagcccattttaggggggatagatgcaaaacccttttagagaaacccaaactc
ttcttcattcaggcttgccgagggacagagctcgatgatggcatccaggctgactcgggg
cccatcaatgacacagatgctaatcctcgatataagatcccagtggaagctgacttcctc
ttcgcctattccacggttccaggctattactcgtggaggagcccaggaagaggctcctgg
tttgtgcaagccctctgctccatcctggaggagcacgggaaagacctggagatcatgcag
atcctcaccagggtgaatgacagagtcgccaggcactttgagtctcattctgatgaccca
cgcttccatgagaagaagcagatcccctgtgtggtctctatgctcacgaaggaactctac
ttcagtcattag

DBGET integrated database retrieval system