KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108543178
Entry
108543178         CDS       T04641                                 

Gene name
FN1
Definition
(RefSeq) fibronectin 1
  KO
K05717  fibronectin 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04151  PI3K-Akt signaling pathway
rbb04510  Focal adhesion
rbb04512  ECM-receptor interaction
rbb04810  Regulation of actin cytoskeleton
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb05100  Bacterial invasion of epithelial cells
rbb05135  Yersinia infection
rbb05146  Amoebiasis
rbb05165  Human papillomavirus infection
rbb05200  Pathways in cancer
rbb05205  Proteoglycans in cancer
rbb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    108543178 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108543178 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108543178 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108543178 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108543178 (FN1)
   05205 Proteoglycans in cancer
    108543178 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    108543178 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108543178 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108543178 (FN1)
   05100 Bacterial invasion of epithelial cells
    108543178 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108543178 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108543178 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108543178 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108543178 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:rbb00536]
    108543178 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:rbb04990]
    108543178 (FN1)
Membrane trafficking [BR:rbb04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    108543178 (FN1)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   108543178 (FN1)
Glycosaminoglycan binding proteins [BR:rbb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   108543178 (FN1)
Domain-containing proteins not elsewhere classified [BR:rbb04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   108543178 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369
Other DBs
NCBI-GeneID: 108543178
NCBI-ProteinID: XP_017748989
LinkDB
Position
Un
AA seq 2478 aa
MLRGPGPGLLLLAVLCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTTVQTTSSGSGPFTDVRAAVYQPQPHP
QPAPYGHCVTDSGVIYSVGMQWLKTQGNKQMLCMCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNTVTGETTPLSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPTSRNT
FAEVTGLSPGVTYYFKVFAVNHGRESKPLTAEQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPGSEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGKERDAPIVNKVVTPLSPPTNLHLETNPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHYSGRPREDRVPPS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSSPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFITHPGYDTGNGIQLPGTSGQQPTVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGLGLNPNASTGQEALSQTTISWAPFQDT
SEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVT
VGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCHCLGFGSGHFRCDSSR
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTVSALAP
RVCFLILDSPFYRHLSSE
NT seq 7437 nt   +upstreamnt  +downstreamnt
atgctcaggggtccggggcccgggctgctgctgctggccgtcttgtgcctggggacagcg
gtgccctccacgggagcctcgaagagcaagaggcaggctcagcaaatggttcagccccag
tccccggtggctgtcagtcaaagcaagcccggttgttatgacaatggaaaacactatcag
ataaatcaacagtgggagcggacctacctgggcaatgccttggtttgtacttgttatgga
ggaagccgaggttttaactgcgagagtaaacctgaagctgaagagacttgctttgacaag
tacactggaaacacttaccgagtgggtgacacttacgagcgtcctaaagactccatgatc
tgggactgtacctgcatcggggctgggcgagggagaataagctgcaccatagcaaaccgc
tgccatgaagggggtcagtcctacaagattggtgacacctggaggagaccacacgagact
ggtggttacatgttagagtgtgtgtgtcttggtaatggaaaaggagaatggacctgcaag
cccatagctgagaaatgttttgatcatgctgctgggacttcctatgtggtcggagaaacc
tgggagaagccctaccaaggctggatgatggtagattgtacttgcctaggagaaggcagc
ggacgcatcacttgcacctctagaaatagatgcaatgatcaggacacgaggacgtcctat
agaattggagacacctggagcaagaaggataatcgaggaaacctgctccagtgcatctgc
acaggcaacggccgaggagagtggaagtgtgagaggcacaccactgtgcagaccacatcg
agcggatctggccccttcaccgatgttcgtgcagctgtttaccaaccgcagcctcacccc
cagcctgccccctatggccactgtgtcacagacagtggtgtgatctactctgtggggatg
cagtggctgaagacacaaggaaataagcaaatgctttgcatgtgcctgggcaacggagtc
agctgccaagagacagctgtaacccagacatacggtggcaactcaaatggggagccatgt
gtcttaccattcacctacaacggcaggacgttctactcctgcaccacagaagggcgacag
gacggacatctttggtgcagcacaacttcgaattatgagcaggaccagaaatattctttc
tgcacggaccatactgttttggttcagactcgaggaggaaattccaatggtgccttgtgc
cacttccccttcctatacaacaaccacaattacactgattgcacttctgagggcaggaga
gacaacatgaagtggtgtgggaccacacagaactatgatgccgaccagaagtttggattc
tgccccatggctgcccatgaggaaatctgcacaaccaatgaaggggtcatgtaccgcatt
ggagatcagtgggataagcagcatgacatgggccacatgatgaggtgcacgtgtgttggg
aacggtcgtggggaatggacatgcattgcctactcgcagcttcgagatcagtgcattgtt
gatgacatcacttacaatgtgaatgacacattccacaagcgtcatgaagagggacacatg
ctgaactgtacatgcttcggtcagggtcggggcagatggaagtgtgatcccgtcgaccaa
tgccaggattcagagactgggacattttatcaaattggagattcatgggagaagtatgtg
catggtgtcagataccagtgctactgctatggccgtggcattggggagtggcattgccaa
cctttacagacctatccaagctcaagtggtcctgtcgaagtatttatcactgagactccg
agtcagcccaactctcaccccatccagtggaatgcaccacagccatctcacatttccaag
tacattctcaggtggaggcctaaaaattctgtaggccgttggaaggaagctaccatacca
ggccacttaaactcctacaccatcaaaggcctgaagcctggtgtggtatacgagggccag
ctcatcagcatccagcagtacggccaccgagaagtgactcgctttgacttcaccaccact
agcaccagcacacctgtgaccagcaacactgtgacaggagagacaactcccctttctccc
cttgtggccacttctgaatctgtcactgaaatcacagccagcagctttgtggtctcctgg
gtctcagcttctgacaccgtgtcgggattccgggtggaatatgagctgagtgaggaggga
gatgagccacagtatctggatcttccaagcacagccacttccgtgaacatccctgacctg
cttcctggccgaaaatacattgtaaatgtctatcagatatctgaggatggggagcagagt
ttgatcctgtctacttcacaaacaacagcgcccgatgcccctcctgaccctactgtggac
caagttgatgacacctcaattgttgttcgctggagcagaccccaagctcccatcacaggg
tacagaatagtctattcaccatcagtagaaggcagcagcacagaactcaaccttcctgaa
actgcaaactccgtcaccctcagtgacttgcaacctggcgtccagtataatatcactatc
tatgctgtggaagaaaatcaagaaagtacacctgttgtcattcaacaagaaaccactggc
accccacgttcagatacagtgccctctcccagggatctgcagtttgtggaagtgacagac
gtgaaggtcaccatcatgtggacaccgcctgagagtgcggtgaccggctaccgcgtggat
gtgatccccgtcaacctgcctggggagcacgggcagaggctgcccaccagcaggaacacc
ttcgcagaagtcaccgggttgtcccctggggtcacctattacttcaaagtctttgccgtg
aaccacgggagggagagcaagcctctgactgccgaacagacaaccaaactggacgctccc
actaacctccagtttgtcaatgaaacggattctactgtcctggtgagatggactccacct
cgggcccagataacaggataccgactgactgtgggcctgacccgaagaggccaacccagg
cagtacaatgtgggtccctctgtctcgaagtacccactgaggaatctgcagcctggatct
gagtacaccgtatccctcgtggccataaagggcaaccaagagagccccaaagccactgga
gtctttaccacactgcagcctgggagctccattccaccttacaacaccgaggtgactgag
accaccattgtgatcacatggacacctgctccaagaattggttttaagctgggtgtacga
ccaagccagggaggagaggcaccacgagaagtgacttcagactcaggaagcatcgttgtg
tctggcttgactccaggagtggaatatgtctacaccatccaagtcctgagagacggaaag
gaaagagatgcgccaattgtaaacaaagtggtgacaccattgtctccaccaacaaacttg
catctggagacaaaccctgacactggagtgctcacagtctcctgggagaggagtaccacc
ccagacattactggttatagaattaccacaacccctacaaacggccagcagggatattct
ttggaagaagtggtccatgctgatcagagctcctgcacttttgataacctgagtcccggt
ctggagtacaatgtcagtgtttacactgtcaaggatgacaaggaaagtgtccctatctct
gataccatcatcccagaggtgccccaactcactgacctaagctttgttgatataaccgat
tcaagcatcggcctgaggtggaccccgctaaactcttccaccattattgggtaccgcatc
acagtagttgcggcaggagaaggtatccctatttttgaagattttgtggactcctcagta
ggatactacacagtcacagggctggagccgggcattgactatgatatcagcgttatcact
ctcattaatggcggcgagagtgcccctactacactgacacaacaaacggctgttcctcct
cccactgacctgcgattcaccaacattggtccagacaccatgcgtgtcacctgggctcca
cccccatccattgatttgaccaacttcctggtgcgttactcacctgtgaaaaatgaggaa
gatgttgcagagttgtcaatttctccttcagacaatgcagtggtcttaacaaatctcctg
cctggtacagaatatgtagtgagtgtctccagtgtctacgaacaacacgagagcacacct
cttagaggaagacagaaaacaggtcttgattccccaactggcattgacttttctgatatt
accgccaactcttttactgtgcactggattgctcctcgagccaccatcactggctacagg
atccgccatcaccccgagcactatagcgggagacctcgagaagatcgggtgcccccctct
cggaattccatcaccctcaccaacctcactccaggcacagagtatgtggtcagcatcgtt
gctcttaatggcagagaggaaagtcccttattgattggccaacaatcaacagtttctgat
gttccgagggacctggaagttgttgctgcgacccccaccagcttgctgatcagctgggat
gctcctgctgtcaccgtgagatattacaggatcacttacggagaaacaggaggaaatagc
cctgtccaggagttcactgtgcctgggagcaagtctacagctaccatcagtggccttaaa
cctggagtcgattataccatcactgtgtatgctgtcactggccgtggagacagccccgca
agcagcaagccaatttccattaattaccgaacagaaattgacaaaccatcacagatgcaa
gtgaccgatgttcaggacaacagcattagtgtcaagtggctgccttcaagttcccctgtt
actggttacagagtaaccaccactcccaaaaatggaccaggaccaacaaaaactaaaact
gcaggtccagatcaaacagaaatgactattgaaggcttgcagcccacagtggagtatgtg
gttagtgtctatgctcagaatccaagtggagagagtcagcctctggttcagactgcagta
accaacattgatcgccctaaaggactggcattcactgatgtggatgtcgattccatcaaa
attgcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagccct
gaggatggaatccatgagctattccctgcacctgatggtgaagaagacactgcagagctg
caaggcctcagaccgggttctgagtacacagtcagtgtggttgccttgcacgatgatatg
gagagccagcccctgattggaacccagtccacagctattcctgcaccaactgacctgaag
ttcactcaggtcacaccaacgagcctgagcgcccagtggacaccacccaatgttcagctc
actggatatcgagtgcgggtgacccccaaggagaagaccggaccaatgaaagaaatcaac
cttgctcctgacagctcatccgtggttgtatcaggacttatggtggccaccaaatatgaa
gtgagtgtctatgctcttaaggacactttgacaagcagaccagctcagggagttgtcacc
actctagagaatgtcagcccaccaagaagggctcgtgtgacagatgctactgagaccacc
atcaccattagctggagaaccaagaccgagacgatcactggcttccaagttgatgctgtt
ccagccaatggccagactccaatccagagaaccatcaagccagatgtcagaagctacacc
atcacaggtttacaaccaggcactgactacaagatctacctgtacaccttgaacgacaat
gcccggagctcccctgtggtcatcgacgcctccactgccattgatgcaccatccaaccta
cgtttcctggccaccacacccaattccttgctggtatcgtggcagccgccacgtgccagg
atcaccggctacatcatcaagtatgagaagcctgggtcttctcccagagaagtggtccct
cggccccgccctggtgtcacagaggctactattactggcctggaaccgggaactgaatat
acaatttatgtcattgccctgaagaataaccagaagagcgagcccctgattggaaggaaa
aagacagacgagcttccccaactggtaacccttccacaccccaatcttcatggaccagag
atcttggatgttccttccacagttcaaaagacccctttcatcacccaccctgggtatgac
actggaaatggtattcagcttcctggcacttctggtcagcaacccactgttgggcaacaa
atgatctttgaggaacatggttttaggcggaccacacctcccacaacagccacccccata
aggcataggccaagaccatacccgccgaatgtaggtgaggagattcaaattggtcacatc
cccagggaagacgtagactatcacctctacccacatgggctgggactcaatccaaatgcc
tctacaggacaagaagctctctctcagacaaccatctcatgggccccattccaggacact
tctgagtacatcatttcatgtcatcctgttggcactgacgaagagcccttacagttcagg
gttcctggaacttccaccagtgctactctgacaggcctcaccagaggtgccacctacaac
atcatagtggaggcactgaaagaccagcagaggcataaggttcgggaagaggttgttacc
gtgggcaactccgtcaatgaaggcttgaaccaacctaccgatgactcatgctttgacccc
tacacggtttcccattacgccgttggagatgagtgggaacgaatgtctgaatcaggcttt
aaactgttgtgccactgcttaggctttggaagtggtcatttcagatgtgattcatctaga
tggtgccatgacaatggtgtgaactacaagattggagagaagtgggaccgtcagggagaa
aatggccagatgatgagctgcacgtgtcttgggaacggaaaaggagaattcaagtgtgac
cctcatgaggcaacgtgttatgatgatgggaagacgtatcacgtaggggaacagtggcag
aaggaatatctcggtgccatttgctcctgcacatgctttggaggccagcggggctggcgc
tgtgacaactgccgcagacctgggggtgaacccagtcccgaaggcactactggtcagtcc
tacaaccagtattctcagagataccatcagagaacaaacactgtaagtgcattagcgcca
cgagtgtgtttcctcatactagacagtcctttctacaggcatctttcttcagaatga

DBGET integrated database retrieval system