KEGG   Aerosticca soli: ALSL_0112
Entry
ALSL_0112         CDS       T06043                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
rbd  Aerosticca soli
Pathway
rbd01040  Biosynthesis of unsaturated fatty acids
rbd01100  Metabolic pathways
rbd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rbd00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ALSL_0112
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rbd01004]
    ALSL_0112
Enzymes [BR:rbd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ALSL_0112
Lipid biosynthesis proteins [BR:rbd01004]
 Desaturase
  First
   ALSL_0112
SSDB
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3
Other DBs
NCBI-ProteinID: BBD78786
UniProt: A0A2Z6E1D1
LinkDB
Position
113619..114812
AA seq 397 aa
MFDTFLNFVAGGLSQARWPMLLLYTLVVTQLTIFTVTLYLHRSQTHRGVDLHPVVAHFFR
FWGWLSTGMVTKEWVAVHRKHHAKVETPEDPHSPQVYGIKKVFWDGVSLYRAATLNKDDL
EKYGRGTPDDWIERALYSRHPYWGISLMLLINVALFGVAGIAIWAVQMAWIPFWAAGFVN
GLGHYWGYRNFESADTSTNLVPWGLWIGGEELHNNHHAFPSSAKFALRKWEFDIGWAVIC
TLRAVGLAKVLRVAPTLDVRPNVHLPDAETLKALLAHRFQAMTDYYRGVIVPTLREEAAH
AGENLKAMPRRLRRALADGGRWLDGEGHERLQALLAHRPTLRTVCEFRNRLAALMEQRGA
EQTLKGLQQWIVEAEQSGIRALQDFAARLKGYALAGS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgttcgataccttcctgaatttcgtcgccggcggtttgagccaggcccgctggcccatg
ctgctgctgtacacgctggtggtcacccagctcaccatcttcacggtgaccctgtacctg
caccgcagccagacccatcgcggcgtcgacctgcacccggtggtcgcgcacttcttccgt
ttctggggctggctcagcaccggcatggtcaccaaggaatgggtggcggtgcaccgcaag
caccacgccaaggtggagacgccggaggatccgcacagcccgcaggtctacggcatcaag
aaggtgttctgggacggtgtctcgctctaccgcgccgccaccctcaacaaggatgatctg
gagaaatacggccgcggcacgccggatgactggatcgagcgcgcgctctacagccgtcat
ccctactggggcatctcgctgatgttgctcatcaatgtcgcgttgttcggcgtcgccggc
atcgcgatctgggcggtgcagatggcctggattccgttctgggcggccggtttcgtcaat
ggcctcggccattactggggctaccgcaatttcgagagcgccgacacctccaccaatctg
gtgccctggggcctctggatcggcggcgaggaactgcacaacaaccatcacgccttcccg
agttcggccaagttcgcgctgcgcaagtgggagttcgacatcggctgggcggtgatctgc
acgctgcgtgcggtgggtctggccaaggtgctgcgcgtggcgccgacgctcgacgtgcgt
cccaacgtgcacctgcccgatgccgagacgctgaaggccttgctcgcccaccgcttccag
gcgatgaccgattactaccgcggcgtgatcgtgccgaccctgcgcgaagaggctgcgcat
gccggcgagaacctcaaggccatgccgcgacgcctgcgccgggcgctggccgacggcggc
cgctggctggacggcgaggggcacgaacgcctgcaggcgctcttggcgcaccggcccacg
ctgcgcacggtgtgcgagttccgcaaccgcctggcggccttgatggaacaacgcggcgcc
gagcagacgctgaagggcctgcagcagtggatcgtcgaggccgagcaaagcggcatccgc
gccctgcaggatttcgccgcgcggctcaagggctatgcgttggcaggctcctga

DBGET integrated database retrieval system