KEGG   Aerosticca soli: ALSL_1283Help
Entry
ALSL_1283         CDS       T06043                                 

Definition
(GenBank) alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rbd  Aerosticca soli
Brite
KEGG Orthology (KO) [BR:rbd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ALSL_1283
Enzymes [BR:rbd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ALSL_1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored DAO AlaDh_PNT_C NAD_binding_7 Glutaredoxin Thi4 NAD_binding_8 FAD_binding_3 K_oxygenase FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: BBD79941
UniProt: A0A2Z6E5B6
LinkDB All DBs
Position
complement(1361712..1363295)
Genome map
AA seq 527 aa AA seqDB search
MLDTELKTQLRGYLEKVVQPIELVASLDDSDASRELEALLADIAELCPKVSVRRADDDPR
RPSFAIQRVGTDIGVRFAGIPLGHEFTSLVLALLQVGGYPPKIAPEVAEQIRNLEGEFHF
ETYFSLSCQNCPDTVQALNAMSVLNPRIRHVAIDGALFPQEVEARQVMAVPTVFLNGEVF
GQGRMNVEEILAKLDTGAAARSAERLKAKAPFDVLVVGGGPAGAAAAIYAARKGIRTGLV
AERFGGQVLDTLAIENFISVPYTEGPKLATALEEHVRDYEVDLMNGERAAQLVPADADGL
HEVVLANGASLKAKALILATGARWRTMNVPGEQNYRNKGVTFCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLVEFDHKLRADEVLQRKLRSLGNVEIIVGAQTTEVLGDGK
KVTGLRYLDRSSGESRELALEGVFVQIGLLPNSDWLKGTVKLSPRGEIEIDARGETSIPG
IFAAGDVSTVPYKQIVIAMGEGAKAALSAFDHLIRLPVAPAATAVAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaccgaactcaagacccaattgcggggctacctcgaaaaggtcgtccagccg
atcgaactggtggcctcgctggatgacagcgacgcctcgcgcgaactcgaagccctgctt
gcggacatcgccgagctctgtcccaaggtcagcgtgcgccgcgccgatgacgacccgcgc
cggccgtctttcgccatccagcgcgtgggtaccgacatcggggtgcgcttcgccggcatt
ccgctcgggcacgaattcacctcgctggtgctggcgctgctgcaggtcggcggctatccg
cccaagatcgcgcccgaggtggccgagcagatccgcaatctcgaaggcgaattccacttc
gagacctacttctcgctctcctgccagaactgtccggacaccgtgcaggcgctcaatgcg
atgagcgtgctcaaccccaggatccgccatgtcgccatcgatggcgccttgttcccgcag
gaagtcgaggcgcgccaggtgatggcggtgccgacggtgttcctgaacggcgaggtcttc
ggtcagggccgcatgaacgtcgaggagatcctcgccaagctcgacaccggcgccgccgcc
cgcagcgcggagcggctcaaggccaaggcgccgttcgacgtcctcgtggtcggcggcggc
ccggccggcgcggcggcggcgatctatgccgcgcgcaagggcatccgcaccgggctcgtc
gccgagcgtttcggcggccaggtgctggacaccctggcgatcgaaaacttcatttcggtg
ccctataccgaaggtcccaagctggccacggcgctcgaggagcacgtgcgcgactacgag
gtcgacctcatgaacggcgaacgggccgcccagctcgtcccggccgatgccgacgggctg
cacgaggtcgtgctggccaacggggcctcgctcaaggccaaggcgctgatcctggccacc
ggcgcgcgctggcgcaccatgaatgtgcccggcgagcaaaactaccgcaacaagggcgtc
accttctgcccgcattgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggc
ggcggcaactccggcgtcgaggcggccatcgacctggccggcatcgtcgcccacgtcacg
ctggtcgagttcgaccacaagctgcgggccgacgaggtcctgcagcgcaagctgcgcagc
ctgggcaacgtcgagatcatcgtcggcgcgcagaccacggaggtgctcggcgacggcaag
aaagtcaccggcctgcgctatctcgatcgctcaagcggcgagtcgcgcgagctcgcgctc
gaaggcgtgttcgtgcagatcggcctgctgcccaacagcgactggctgaagggcacggtg
aagctgtcaccgcgcggcgagatcgagatcgacgcccgtggcgaaacctccatcccgggc
attttcgccgccggcgacgtcagcacggtgccgtacaagcagatcgtgatcgcgatgggc
gaaggtgccaaggcggcactcagcgcgttcgatcacctcatccgcttgccggtcgcgcct
gccgccacggccgtggcggcctga

DBGET integrated database retrieval system