KEGG   Rickettsia bellii RML369-C: RBE_1164Help
Entry
RBE_1164          CDS       T00339                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rbe  Rickettsia bellii RML369-C
Pathway
rbe00020  Citrate cycle (TCA cycle)
rbe00190  Oxidative phosphorylation
rbe00650  Butanoate metabolism
rbe01100  Metabolic pathways
rbe01110  Biosynthesis of secondary metabolites
rbe01120  Microbial metabolism in diverse environments
rbe01130  Biosynthesis of antibiotics
rbe01200  Carbon metabolism
Module
rbe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rbe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBE_1164 (sdhA)
   00650 Butanoate metabolism
    RBE_1164 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RBE_1164 (sdhA)
Enzymes [BR:rbe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RBE_1164 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     RBE_1164 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_oxidored FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABE05245
UniProt: Q1RHB9
LinkDB All DBs
Position
complement(1258971..1260761)
Genome map
AA seq 596 aa AA seqDB search
MTKSYNIIHHKFDVIVVGAGGAGLRAAFGMAEEGLNTACISKLFPTRSHTVAAQGGISAA
LGNMGADDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ
RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFIEYFAIDLLMENGE
CRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQDM
EFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIE
IREGRGVGEHKDHVFLHLNHLSPEIVHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYHGQVIIKDGKNHNSVVKGLMSIGEAACVSVHGANRLGSNSLLDLVVFGRSAAL
KAAELIKPASPHKPVSEEALEKIISRFDKIRHSSGNISVADLRLKMQRTMQSHASVFRTQ
EVLDEGAEMISEIRSGYKDIKVNDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKESR
GAHAREDYPDRNDKEWMQHTLSGVDEAGKVVLDYKPVTLTTLSDEVKAIPPAKRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatcgtataatataattcatcataaatttgacgtaatagtcgtaggggcaggc
ggtgcaggtttacgtgctgcgttcggtatggctgaagagggtcttaatacggcttgtata
tctaagctattcccgactcgtagccatactgtcgcagcacaaggcggtattagtgcagct
cttggtaatatgggagcggatgattggcgttggcatatgtatgatacggttaaaggttct
gattggttaggcgatcaggatgcaatcgaatatatgtgcaagaatgctccggatgcgatt
ttagagcttgagcattacggcgtacctttttcaagaaccgaagagggaaaaatttatcag
cgtccttttggcggcatgactaccgagtatggcaaaggcaaggcagcacaacgtacatgt
gcagcagcagatcgtactggacatgctatacttcatactttatatcaacaatcattaaag
cataaagtacagttttttatcgaatatttcgctattgatttattaatggaaaatggtgaa
tgtagaggagtagttgcttggaatttagatgatggtagcttgcattgttttagagcacat
aatgtagtacttgcaacgggcggatatgggcgtgcttatttttcagcaacttcggctcat
acttgcactggtgacgggggcggaatggcgattagagcaggcttgccgctgcaagatatg
gagtttgtccagttccatccgaccggaatatattcagctggttgccttataacagaggga
gctagaggtgagggtggttatcttgttaacgctaatggtgagcgtttcatggagcgttat
gcaccggctgcaaaggatttagcatcacgggatgtggtttcaagagcaatgactatcgaa
attcgtgaggggcgaggagttggagagcataaagatcatgtattcttgcatttaaatcat
ttatcacctgaaattgtacatagtcgtttgcctggtatttctgaaacagctaaaattttt
gctggtgttgatgtaaccaaagagcctataccggtacttcctacagtgcattataatatg
ggtggaatacctactaattatcatggtcaggtaataattaaagatggcaaaaatcataat
agtgtagtaaaaggtcttatgtcgatcggtgaagccgcttgtgtatcggtgcatggagct
aatcgtctaggatcaaattccttacttgatttagtagtattcggcagaagtgcagcacta
aaagcagctgagcttattaagccagcaagtccgcataagcctgtatcagaagaagccctt
gaaaaaattattagtagatttgataaaattcgtcatagtagcggtaatatctcggttgca
gatttaaggcttaaaatgcaaagaactatgcaaagtcatgcttcagtgtttagaactcaa
gaagtgctagatgagggggcagaaatgattagcgagataagaagcggttacaaagatata
aaagttaatgataaatctttaatttggaatagcgatttagttgaagctttagagctagat
aatttacttgatcaggctttagtaactgtatattcagcagctgccagaaaagaaagcaga
ggagcacacgcaagggaagattatcccgatcgtaatgataaagaatggatgcagcacact
cttagcggggttgatgaagccggcaaggtggtgcttgattacaaacctgttactttaact
actttgagtgatgaagtgaaagcaattccaccagcgaagagagtatactag

DBGET integrated database retrieval system