KEGG   Rhodospirillum centenum: RC1_2871
Entry
RC1_2871          CDS       T00785                                 

Gene name
ptsI
Definition
(GenBank) phosphoenolpyruvate-protein phosphotransferase
  KO
K08483  phosphoenolpyruvate-protein phosphotransferase (PTS system enzyme I) [EC:2.7.3.9]
Organism
rce  Rhodospirillum centenum
Pathway
rce02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:rce00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    RC1_2871 (ptsI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rce02000]
    RC1_2871 (ptsI)
Enzymes [BR:rce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     RC1_2871 (ptsI)
Transporters [BR:rce02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    RC1_2871 (ptsI)
SSDB
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers HpcH_HpaI
Other DBs
NCBI-ProteinID: ACJ00241
UniProt: B6IVB7
LinkDB
Position
2951845..2953641
AA seq 598 aa
MKTDRPPKTDRPPTPPQDRILRGLGVSAGIAIGPAHLVESGSLQVPEYPVPADGIEEEVT
RFQVAVEKARKQISKLKAKASVLPGSASEDVGFLLDAHLAMLTGSRLIRGVERRMRDLRC
NAEAAVQAEIAAIAQTFAEMDDAYLSARVADVREVGKRLLRILMDRKYQAFATLPEGAVV
LAEELTPADTALMDPRRIAGFATLLGGAEGHTAIMARSLGLPAVLGVPGVLAGVQPGDMV
VVDGIAGRVCLNPSPAMLEEYRHRREALLAERRQLKSLRRLPSVTRDGTDVTLLANLELP
REVETAVEAGAAGVGLLRTEFLFMNRDDLPDEEEQTAQLTDFLRRMNGQPVTARTLDVGG
EKLATALRQPLGEPANPALGLRAIRLGLREPKLLETQLAAMLRAAAEGPLRILLPMICAP
AEVRKVREIMATVARRLRRRGVRIANPLPRLGVMIEVPGAALSADALAPLCDFFAIGTND
LVQYTLAIDRGDEQVAHLYDPLHPAVLRLVQFTVDAATRAGIPVSVCGEMAGDPRYTALL
LGLGVRELSMSPGNLPLVKRRVRSLDLVEATRRARVIMEQSDSGRIAALLDDFNGLAA
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgaagactgaccgtccaccgaagaccgaccgaccgccgaccccgccgcaggaccgcatc
ctgcgcggtctcggcgtgtccgccggcatcgccatcggcccggcgcacctcgtcgagtcg
ggctccctccaggtgcccgaatatccggtgccggccgacggcatcgaggaggaggtgacg
cgcttccaggtggcggtggagaaggcgcgcaagcagatcagcaagctgaaggccaaggca
tcggtgctgccgggatcggcgtcggaggatgtcggcttcctgctcgacgcgcatctggcg
atgctgaccggctcgcggctcatccgcggcgtggagcggcgcatgcgcgatctccgctgc
aatgccgaggcggccgtgcaggcggagatcgccgccatcgcccagaccttcgccgagatg
gacgacgcctatctgtccgcccgcgtcgccgacgtgcgcgaggtgggcaagcggctgctg
cgcatcctgatggaccgcaagtaccaggccttcgccaccctgccggaaggggccgtcgtg
ctggcggaggaactgacccccgccgacaccgccctgatggacccgcgccgcatcgccggc
ttcgccaccctgctgggcggggccgaggggcacacggcgatcatggcccgctcgctgggc
ctgccggcggtgctgggtgtgcccggcgtcctggccggggtgcagccgggcgacatggtg
gtggtggacggcatcgccggccgggtctgcctgaacccctcgccggccatgctggaggaa
taccggcaccggcgcgaggcgctgctggccgagcggcggcagttgaagtcgctgcgccgg
ctgccgtcggtcacccgcgacggcaccgacgtcaccctgctggcgaacctggaactgccg
cgcgaggtggagacggcggtggaggcgggggccgccggcgtggggctgctgcgcaccgag
ttcctgttcatgaaccgcgacgacctgcccgacgaggaggagcagaccgcgcagctgacc
gacttcctgcgccgcatgaacggccagccggtcaccgcccgcaccctggacgtgggcggg
gagaagctggcgacggcgctgcgccagcccctgggcgagccggccaacccggcgctgggc
ctgcgcgccatccgcctgggcctgcgcgagccgaagctgctggagacgcagctcgccgcc
atgctgcgggcggcggcggaggggccgctgcgcatcctgctgccgatgatctgcgccccg
gccgaggtccggaaggtgcgggagatcatggcgaccgtggcccgccggctgcgccggcgc
ggcgtgcggatcgccaacccgctgccccggctgggggtgatgatcgaggtgccgggggcg
gcgctgtcggccgatgcgctggccccgctgtgcgacttcttcgccatcgggacgaacgat
ctggtgcagtacacgctggccatcgaccgcggcgacgaacaggtggcgcatctctacgac
ccgctgcatccggccgtgctgcggctggtgcagttcacggtcgatgccgcgacccgcgcc
ggcatccccgtcagcgtctgcggcgagatggcgggcgatccgcgctacacggcgctgctg
ctggggctgggggtgcgcgaactgtcgatgtcgccgggcaaccttccgctggtgaagcgg
cgggtgcgctcgctcgacctggtggaggcgacccgccgcgcccgggtcatcatggagcag
tccgacagcggccgcatcgccgccctgctggacgatttcaacgggctggccgcctga

DBGET integrated database retrieval system