KEGG   Rickettsia conorii: RC0480
Entry
RC0480            CDS       T00061                                 

Gene name
mpg
Definition
(GenBank) DNA-3-methyladenine glycosidase
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
rco  Rickettsia conorii
Pathway
rco03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:rco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    RC0480 (mpg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rco03400]
    RC0480 (mpg)
Enzymes [BR:rco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     RC0480 (mpg)
DNA repair and recombination proteins [BR:rco03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     RC0480 (mpg)
 Prokaryotic type
     RC0480 (mpg)
SSDB
Motif
Pfam: Pur_DNA_glyco
Other DBs
NCBI-ProteinID: AAL03018
UniProt: Q92IE0
LinkDB
Position
complement(475819..476370)
AA seq 183 aa
MNKLIPVPREFFARDTNVVSTELIGKALYFQGKTAIITETESYIGQNDPACHAARGRTKR
TDIMFGPAGFSYVYLIYGMYYCLNFVTEAKGFPAATLIRGVHVILPENLYLNGPGKLCKY
LGINISHNKCDLINNNEFFVGDIGLKLPYSTTARIGITKGTDKLWRYVVTDITNLISQYN
VQP
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaataaactaatccctgtacctcgtgaattttttgcaagagatactaatgtagtaagc
actgagttaatcggtaaagctctttatttccaaggtaaaacagctatcattactgaaact
gaaagctatatagggcagaatgatcctgcttgccatgcagcaagagggcggacaaaaaga
acggatataatgtttggtcctgcaggctttagctatgtctatttaatttacggaatgtat
tattgtttaaatttcgtaaccgaagctaaaggcttccctgctgcaaccttaataagagga
gtacatgttattttgcctgaaaatctatacctcaacggtccgggtaaattatgcaaatat
ctaggaattaatatttctcataataaatgcgatcttataaataacaacgaattttttgtc
ggcgatatcggcttaaagctaccctactctactactgctcgtataggtattactaaaggc
acggataaattatggcgttatgttgttacagatatcactaatttaatctctcaatataat
gtacagccttaa

DBGET integrated database retrieval system