Rhodococcus coprophilus: NCTC10994_00173 Help Entry NCTC10994_00173   CDS       T06666                                  Symbol dmpI Name (GenBank) tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism rcr  Rhodococcus coprophilus Pathway rcr00362   Benzoate degradation rcr00621   Dioxin degradation rcr00622   Xylene degradation rcr01100   Metabolic pathways rcr01120   Microbial metabolism in diverse environments rcr01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:rcr00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     NCTC10994_00173 (dmpI)    00622 Xylene degradation     NCTC10994_00173 (dmpI)    00621 Dioxin degradation     NCTC10994_00173 (dmpI) Enzymes [BR:rcr01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      NCTC10994_00173 (dmpI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 DUF1542 Tautomerase_3 GA Motif Other DBs NCBI-ProteinID:  SQI28429 UniProt:  A0A2X4TQ02 LinkDB All DBs Position 1:complement(182455..182634) Genome browser AA seq 59 aa AA seqDB search MPLIQISQTPGLTAEQKSAVIAAVTEAYAEAAGKNPDKVWVTITEVPGENWGVGGVPLS NT seq 180 nt NT seq  +upstreamnt  +downstreamnt gtgccattgattcagatcagccagaccccgggcctgaccgccgagcagaagagcgcggtg atcgccgcggtgaccgaggcctacgccgaagcagccggaaagaaccccgacaaggtgtgg gtgaccatcaccgaggtcccgggggagaactggggcgtcggcggcgtaccgctgagctga

DBGET integrated database retrieval system