KEGG   Cupriavidus necator H16: H16_A0302Help
Entry
H16_A0302         CDS       T00416                                 

Gene name
dac
Definition
(GenBank) D-Alanyl-D-alanine carboxypeptidase (serine-type)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
reh  Cupriavidus necator H16
Pathway
reh00550  Peptidoglycan biosynthesis
reh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H16_A0302 (dac)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:reh01002]
    H16_A0302 (dac)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:reh01011]
    H16_A0302 (dac)
Enzymes [BR:reh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     H16_A0302 (dac)
Peptidases and inhibitors [BR:reh01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   H16_A0302 (dac)
Peptidoglycan biosynthesis and degradation proteins [BR:reh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   H16_A0302 (dac)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: CAJ91453
UniProt: Q0KEW8
LinkDB All DBs
Position
1:319911..321110
Genome map
AA seq 399 aa AA seqDB search
MLNRATTRLSSAFAPAAIAAAIVLAAAPAAVLAQGVPMPQVAAKSWMLYDVTSGQALASQ
NADARIEPASLTKLMTAYLAFEALKEKRLTLDQAVVPTSVVLKVKSDESRMFIEPNKPVT
VQDLLLGLIVQSGNDAALALAEAVGGSEEGFVAMMNREAQRMGMKNTHFTNTDGIPDPNH
YTTAVDLATLTTRLIKDFPEYYAMYSQKEFTYNKIRQPNRNRLLYIDPTVDGVKTGHTKS
AGYCLISSAKRPLANVPDGSRRLISIVIGTTTEQVRTQESLKILNYGFQFFDTLRLYDKG
QVLATPDIYKGKSGTVKIGVQNETFVTVPKGTGGRLKPVLERQELLIAPISAGQQVGMVK
LMDGTNKVAEFPVVALEEVPEAGFFGRLWDTIRLWFKRK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatcgagccacgacacgcctttcgtccgcttttgctcccgccgccatcgccgcc
gccatcgtgctggccgccgcgcctgccgccgtcctggcgcagggcgtgccgatgccgcaa
gtcgcagccaagtcgtggatgctgtatgacgtgaccagcggccaggccctggcgtcgcag
aatgccgatgcgcgcatcgagccggcctcgctgaccaagctgatgaccgcctacctggcg
ttcgaggcactcaaggaaaagcgcctgacgctggaccaggcggtggtgccgaccagcgtg
gtgctcaaggtcaaaagcgacgagtcgcgcatgttcatcgagcccaacaagccggtcacc
gtgcaggacctgctgctgggcctgatcgtgcagtcgggcaacgacgccgcgctggcgctg
gccgaagccgtgggcggctcggaagagggcttcgtcgcgatgatgaaccgcgaggcccag
cgcatgggcatgaagaacacccacttcaccaacaccgacggcattcccgacccgaaccac
tacaccaccgcggtcgacctggccacgctgaccacgcgcctgatcaaggactttcccgag
tactacgccatgtactcgcagaaggagttcacctataacaagatcaggcagcccaaccgc
aaccgcctgctgtacatcgacccgaccgtggacggcgtcaagaccggccacaccaagtcc
gccggctactgcctgatctcgtcggccaagcggccgctggccaacgtgccggacggctcg
cgccgcctgatctcgatcgtgatcggcaccaccaccgaacaggtgcgcacccaggaaagc
ctgaagatcctcaactacggcttccagttcttcgacacgctgcgcctgtacgacaagggc
caggtgctggccacgccggacatctacaagggcaagagcggcacggtcaagatcggcgtg
cagaacgagaccttcgtcaccgtgcccaagggcaccggcggacgcctcaagccggtgctg
gagcgccaggaactgctgatcgcgccgatctcggcaggccagcaggtgggcatggtcaag
ctgatggacggcaccaacaaggtggcggagttcccggtggtggcgctggaagaagtgccc
gaggccggcttcttcggccgcctgtgggacaccatccgcctgtggttcaagcgcaagtga

DBGET integrated database retrieval system