KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH02891Help
Entry
REMIM1_CH02891    CDS       T02778                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00473  D-Alanine metabolism
rel00550  Peptidoglycan biosynthesis
rel01100  Metabolic pathways
rel01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    REMIM1_CH02891 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    REMIM1_CH02891 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    REMIM1_CH02891 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rel01011]
    REMIM1_CH02891 (ddl)
Enzymes [BR:rel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     REMIM1_CH02891 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:rel01011]
 Precursor biosynthesis
  Amino acid ligase
   REMIM1_CH02891 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp ATP-grasp_3 GARS_A Arg_repressor
Motif
Other DBs
NCBI-ProteinID: AGS22650
UniProt: S5RYV8
LinkDB All DBs
Position
complement(2861932..2862858)
Genome map
AA seq 308 aa AA seqDB search
MSRKHVAVLMGGFSSERPVSLSSGKACAEALEAEGFKVTTLDVARDVSEKLAALKPDVVF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKDKAKRVAAAAGVPVAESQVINR
FAFPATHPMKPPYVVKPVREGSSFGVVIVTEDQAHPPQVVSSPEWHYGEDVLVERYVYGR
ELTCGVMGDVALGVTEVVPLGHNFYDYDSKYAAGGSKHVIPAKISPNIYQKIQTLALRAH
QAIGCRGVSRSDFRYDDRLSDDGEIIWLEVNTQPGMTPTSLVPEMAGHAGYSFGQFLRWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcaagcatgtcgctgtcctgatgggcggattttcctcggaaaggcctgtcagc
ctttcctcgggaaaggcttgcgcagaggccctcgaagccgaaggcttcaaggtaaccacg
cttgatgtcgcccgcgatgtttctgaaaagcttgccgcattgaagccggatgtcgtcttc
aatgcgcttcatgggccgttcggcgaggacgggaccattcagggcatcctggaatatctg
gagatcccctatacgcattcaggcgtgcttgcctcggcgcttgcgatggacaaggacaag
gcgaagcgtgtcgctgccgccgccggggtccctgtcgccgaatcgcaggtcatcaaccgt
ttcgcctttcctgcgacgcatccgatgaagccgccttatgtggtgaagccggtgcgcgaa
ggctcgagcttcggcgtcgtcatcgtcacggaagatcaggcgcatccgccgcaggtcgtc
agctcgcccgagtggcattatggcgaggacgttctcgtcgagcgctacgtttacggccgc
gagctcacctgcggagtcatgggtgatgtcgcgctcggcgtcacggaagtggtgccgctg
ggacacaatttttatgattacgattccaagtacgctgcgggcggttcaaaacacgtcatc
ccggcgaaaatttcaccgaatatttaccaaaaaatacaaacattggccctaagggcgcat
caggcaatcggttgccgcggcgtcagtcggtccgactttcgttacgacgatcgtctctcc
gacgacggcgaaatcatctggctggaagtcaatacccagcctggcatgactccaacctcg
ctcgtgcccgaaatggccggtcatgccggctattcgtttggtcagtttctccggtggatg
gtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system