KEGG   Rhodococcus hoagii: REQ_13870Help
Entry
REQ_13870         CDS       T01352                                 

Definition
(GenBank) putative secreted protein
Organism
req  Rhodococcus hoagii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CBH47471
UniProt: A0A3S5Y4P5
LinkDB All DBs
Position
complement(1441662..1444481)
Genome map
AA seq 939 aa AA seqDB search
MRLPKPRSPLPAVSPPLPVPLPEALPEPRSARLPRSALPTSVPPVLPASPVDPSAAALPT
TGRAKLPNGSAKLPSAASPRLPRSRSPLPAVSSPLPVSRLPVSLPESLPVPRSARLPRST
RPPRSALPTSVPPVLPASPVDPSAAALPTTGRAKLPNGSAKLPSAASPRLPRSRSPLPAV
SSPLPVSRLPVSLPESLPVPRSARLPRSTPRLPSASSPKLPRSRSPLPELNSPLPVSRLP
VSLPESLPDPRSARLPRSTRPPRSALPTSVPPALPASPVDPSAAALPATGRAKLPNGSAK
LPSAASPKLPRSRSPLPAARSPLPVSRLPVSLPESLPEPRSARLPRSTTPPRSALPTSAP
PVLPASPVDPSAAALPTTGRAKLPNGSAKLPSTASPKLPGSNSAALPASALPESKLPSAR
SARLPKSRSPLPEINSPLPVSPLPESMPPSLPEPRSARLPRSTRPPRSALPTSAPPVLPA
SPVDPSAAALPTTGRAKLPNGSAKLPSAASPKLPGSNSAALPASALPESKLPSARSARLP
KSRSPLPEINSPLPVSPLPESMPPSLPEPRSARLPRSTRPPRSALPTSAPPVLPASPVDP
SAAALPTTGRAKLPNGSAKLPSAASPKLPGSRSPLPAARSPLPAGRSTLPEANSAKLPKS
RVGSALPAGSPRLPSARSARLPRSTPPSPELPSASCAKAARSRLPLPESRSARLPTSPLP
EASLPVSALPPPTSPALPAARSPMTPSPSSRLPAPGAAPALPAPESLPMSPRLPASASPR
LPTPSSGIASVTLPASIPPPRLPVPRFARLPNAVCARFAKSRLPALPASTPPLAPPGPAA
LPKPASPFPPMLLPRPESPPFAPPFALLPNPFWGAGWASPTAGVAIVKAPTAVAATMIRL
FIRSVLELRALWVDIVPHPPRSACQRRTTNTHRMKTENR
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctccccaagccgaggtcaccgcttcctgcggtcagcccgccgcttcccgtgccg
ctgccggaggcactgcccgaaccgaggtccgccaggctaccgaggtccgcactacccaca
tcggtaccaccggtgctgcccgcatcccctgtggacccgagtgccgcggcactaccgaca
accggcagagccaaacttccgaacggaagcgccaagctacctagcgcagcctcacccagg
ctgcccaggtccagatcgccactgccggctgtcagctcaccgctaccggtctccaggctg
ccggtgtcgctaccggaatcactgcccgtacccaggtcagccaggctccccagatccacc
agaccaccaaggtccgcgctacccacatcggtaccaccggtgctgcccgcatcccctgtg
gacccgagcgccgcggcactaccgacaaccggcagagccaaacttccgaacggaagcgcc
aagctacctagcgcagcctcacccaggctgcccaggtccagatcgccactgccggctgtc
agctcaccgctaccggtctccaggctgccggtgtcgctaccggaatcactgcccgtaccc
aggtcagccaggctacccagatcgacacccaggcttcccagcgcaagctcacccaagcta
cccaggtcgagatcaccactgccggagctcaactcaccactaccggtctccaggctgccg
gtgtcgctaccggaatcgctgcccgaccccaggtcagccaggctccccagatccaccaga
ccaccaaggtccgcgctacccacatcggtaccaccggcgctccccgcatcgcccgtggac
ccgagcgccgcggcactaccggcaaccggcagagccaaactcccgaacggaagcgccaaa
ctccccagcgcagcctcacccaagctgcccaggtccagatcgccgctgccggcggcgaga
tcgccactaccggtctccaggctgccggtgtcgctaccggaatcactgcccgaacccagg
tccgccaggctccccagatccaccacaccaccaaggtccgcactacccacatcggcacca
ccggtgctgcccgcatcccccgtggacccgagcgccgcggcactaccgacaaccggcaga
gccaaactcccgaacggaagcgccaaactccccagcacagcctcacccaagctgcccgga
tccaactccgcagcactccccgcgtctgcactacccgaatccaagctccccagcgcgagg
tccgcgaggctgcccaaatccagatcgccactacccgaaatcaactcgccactaccggtg
tcgccgctaccggagtcgatgcccccctcgctacccgaacccaggtccgccaggctcccg
agatccaccagaccaccgaggtccgcactccccacgtcggcacccccggtgctgcccgca
tcccccgtggacccgagcgccgcggcactaccgacaaccggcagagccaaactcccgaac
ggaagcgccaaactccccagcgcagcctcacccaagctgcccggatccaactccgcagca
ctccccgcgtctgcactacccgaatccaagctccccagcgcgaggtccgcgaggctgccc
aaatccagatcgccactacccgaaatcaactcgccactaccggtgtcgccgctaccggag
tcgatgcccccctcgctacccgaacccaggtccgccaggctcccgagatccaccagacca
ccgaggtccgcactccccacgtcggcacccccggtgctgcccgcatcccccgtggacccg
agcgccgcggcactaccgacaaccggcagagccaaactcccgaacggaagcgccaaactc
cccagcgcagcctcacccaagctgcccggatccaggtcgccgctgccggcggcgagatcg
ccacttccggcaggtaggtccacgctccccgaggccaactcggccaagctgcccaagtcg
agggtcggctcggcgctgccggcgggcagtcccaggctgccgagtgccaggtccgcgagg
cttccgaggtcgactccgccgtcgccggagctgcccagcgccagctgcgccaaagcggcc
aggtcgaggttgccgcttcctgagtccagatcagcgaggcttccgacatcgccgctcccg
gaggcgtcgctgccggtatcggcgctaccgcccccgacctcgccggcgctgcctgcggcc
aggtcaccgatgacaccgagtcctagttcgaggctgcccgcgcccggagcggctccggca
ctgcctgctcccgagtcgcttccgatgtcgcccaggctgccggcatccgcctcgccgagg
ctgccgacgccgagttcgggcatcgcatccgtcacgctcccggcgtcgatcccgccgccg
aggctgcctgtgcccagattcgcgaggctgcccaacgcggtctgtgcaaggttcgccaag
tcgaggttaccggcgctgcccgcgtcgacgcccccgttggcgcctccgggccccgcggcg
ctaccgaagccggcgtcaccgttcccgccgatgctgctgcccagacccgagagtccgccg
tttgcgccgccgttcgcgctgctcccgaatccgttctggggagcgggctgggcctcgccg
accgccggcgtggcaatcgtcaaagccccgactgcggtggccgcgaccatgatccggctc
ttcatccgcagtgttctcgagttgcgggctctgtgggtagacatcgttcctcatcctcct
cgatcggcatgccagcgacgcacaacaaacacccaccgcatgaagacagaaaacaggtga

DBGET integrated database retrieval system