KEGG   Rhodococcus erythropolis PR4: RER_10480Help
Entry
RER_10480         CDS       T00881                                 

Definition
(GenBank) putative alanine aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00220  Arginine biosynthesis
rer00250  Alanine, aspartate and glutamate metabolism
rer00290  Valine, leucine and isoleucine biosynthesis
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01130  Biosynthesis of antibiotics
rer01210  2-Oxocarboxylic acid metabolism
rer01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rer00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RER_10480
   00290 Valine, leucine and isoleucine biosynthesis
    RER_10480
   00220 Arginine biosynthesis
    RER_10480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rer01007]
    RER_10480
Enzymes [BR:rer01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     RER_10480
    2.6.1.66  valine---pyruvate transaminase
     RER_10480
Amino acid related enzymes [BR:rer01007]
 Aminotransferase (transaminase)
  Class I
   RER_10480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Aminotran_MocR Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAH31756
NITE: RER_10480
UniProt: C0ZRK6
LinkDB All DBs
Position
complement(1170049..1171269)
Genome map
AA seq 406 aa AA seqDB search
MNTPIDQARKLENVRYDIRGRILDKTEELEDQGHTILRLNVGNPAPFGFEAPDEIMMAMI
RNLPTAQGYCDSRGLYSARTAVVQYYQTRGITDVTVDEIYLGNGVSELITLTMQALCNPE
DEILIPAPDYPLWTASVSLAGGTPVHYLTDESQGWAPDFDDLEARISPRTRGIVVINPNN
PTGAVYSTEVLQRFVDIARKHDLMLFADEIYEKIVYDGRSMTNLASMTGRDVLCLTYSGL
SKAYRVCGFRAGWLAITGPLERASSFIEGIKLLANMRMCANVPAQHAIQTALGGRQSIED
LLLPQGRLTAQRDLAHSTLNSIDGISCQQADGALYLFPKLDVDKFGIVDDERFVLDLLES
EKILVSHGRAFNWIEPDHFRLVTLPNTDDLATALERLGNFLSSYSQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacacccatcgatcaggcccgcaagctcgagaatgtcaggtacgacatcagaggg
cgaattctcgacaagaccgaagaactcgaggatcagggacacacgatcctgcgactcaac
gtcggcaatccggccccctttggattcgaagcaccggacgaaatcatgatggccatgatc
cgcaatctccctaccgcccagggatattgcgattctcgcggactgtattcggcgcgcacc
gcggtggtccagtactaccagacgcggggtatcaccgacgtcaccgtcgacgagatctat
ctcggaaacggcgtctccgaactgatcacgctgacgatgcaggcgctctgcaatcccgag
gacgagatcctgattcccgctcccgactaccccttgtggacggcttcggtttcacttgcc
ggcggcacgccggttcactacctcaccgatgaaagccagggctgggcaccggacttcgac
gatctggaagcccggatctctccgcgcacccgagggattgtcgtcatcaatcccaacaat
ccgacgggcgccgtctactcgacggaggtgctgcaacgcttcgtcgacattgcccgcaag
catgacctgatgctcttcgccgacgagatctacgagaagatcgtctacgacggccgatcc
atgacaaaccttgcgtcgatgaccgggcgagacgttttgtgtctgacgtactcggggctg
tccaaggcctaccgcgtctgcgggttccgagccggatggctggccatcaccggaccactc
gagcgggcgtcgagtttcatcgaaggcatcaaactgctggccaacatgcgaatgtgtgcc
aatgtgccggcgcagcacgcgatccagaccgcactcggcggacgccagtccatcgaggac
ctcctgctcccgcagggccgactgacagcacagcgcgatctcgcgcacagcacgctcaac
agcatcgacgggatcagctgtcagcaggccgacggcgcgctgtatctgttcccgaagctc
gacgtcgacaagttcggcatcgtcgacgacgagaggttcgttctcgatctactggaatcg
gagaagattctggtcagtcacggccgcgcgttcaattggatcgaacccgaccactttcgg
ttggtgaccctgccgaacaccgacgacctcgcgaccgccctcgagcggctcggcaacttc
ctcagttcctacagccagtaa

DBGET integrated database retrieval system