KEGG   Cupriavidus pinatubonensis JMP134: Reut_A3130Help
Entry
Reut_A3130        CDS       T00268                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01130  Biosynthesis of antibiotics
reu01230  Biosynthesis of amino acids
Module
reu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Reut_A3130
Enzymes [BR:reu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Reut_A3130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 AAA_17 FtsK_gamma AAA AAA_16 Cytidylate_kin APS_kinase AAA_22 TsaE
Motif
Other DBs
NCBI-ProteinID: AAZ62490
UniProt: Q46WJ3
LinkDB All DBs
Position
1:complement(3440214..3440792)
Genome map
AA seq 192 aa AA seqDB search
METGRPNLFFVGLMGAGKTTVGRTVARRLHYPFFDSDHELEAHCGVRIPVIFEHEGEEGF
RDREAAMIRELTGRSGIVLATGGGAVLRPENRELLKSRGTVVYLRASPHDLWLRTRHDRN
RPLLQTEDPKGKLEALYGARDPLYREVADFIIETGKPSVAQLANMVLMQLEMAGFRIDTA
AASDQPANDTHS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggagaccggccgtcccaacctcttcttcgtcggcttgatgggcgccggcaagactacc
gtgggccggacggtcgcgcggcgcctgcactatccgttttttgattccgaccacgagctg
gaagcgcactgcggcgtgcgcatcccggtgattttcgagcacgagggcgaagaaggtttc
cgcgaccgcgaggccgccatgatccgtgaactcaccggccgcagcggcattgtgcttgcc
acaggcggcggcgcggtgctgcggcccgaaaaccgcgaactgctcaaatcacgcggcact
gtggtctacctgcgcgccagcccgcacgacctgtggctgcgcacccgtcacgaccgcaac
cgcccgctgctgcagaccgaggatccgaagggcaagctcgaagcgctctatggcgcgcgc
gacccgctttaccgcgaggtggccgatttcatcatcgagaccggcaagccctcggtggca
cagcttgctaatatggtgctgatgcagctggaaatggccggtttccgcatcgacaccgcc
gccgcgtcggaccagccggccaacgatacgcattcatga

DBGET integrated database retrieval system