KEGG   Rhizobium gallicum: RGR602_CH01073Help
Entry
RGR602_CH01073    CDS       T03539                                 

Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rga  Rhizobium gallicum
Pathway
rga00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RGR602_CH01073
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rga02000]
    RGR602_CH01073
Enzymes [BR:rga01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RGR602_CH01073
Transporters [BR:rga02000]
 Other Transporters
  Pores ion channels [TC:1]
   RGR602_CH01073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AJD40431
UniProt: A0A0B4WZR2
LinkDB All DBs
Position
1084165..1084785
Genome map
AA seq 206 aa AA seqDB search
MLTFYFAQSTCALASLIALEESGLAYEARMISFKDNEQRSPEYLKINPKGRVPALVTDRG
IVTETPAILAYIAQTVPAARLAPLDDSFEFARLQAFNSYLCSTVHVNHAHKRRGSRWADD
PAAHEAMQAKVPQTMTENFELIEETMLAGPWVMGEQYSVADPYLFTMTGWLRGDGVDPMR
FAKATAHYARMMDRPAVQRALTIEKG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgacattttatttcgcgcaaagcacctgtgcgctggcaagtctcatcgcgctggag
gagtccgggcttgcctatgaagcaaggatgataagcttcaaggacaacgagcagcgctcg
ccggaatatctgaagatcaacccgaagggccgcgtcccggccctcgtcaccgatcgcggc
atagtcaccgaaacgccggcgatcctcgcctatatcgcgcagaccgtcccagcggccagg
ctcgcgccgctcgacgactccttcgagttcgcccgcctgcaggccttcaacagctacctc
tgctcgaccgtgcatgtgaaccatgcacacaagcgacgcggttctcgctgggccgacgat
cccgccgcgcacgaagccatgcaggccaaggtgccgcagaccatgacggaaaacttcgaa
ctcatcgaggagacgatgctcgccggcccctgggtcatgggcgagcagtattccgtcgcc
gatccctatctcttcaccatgaccggctggctgcgcggcgacggcgtcgacccgatgcgc
ttcgccaaggccaccgcccattacgcccggatgatggatcgcccggcggtgcagcgggcg
ctgacgattgaaaagggatga

DBGET integrated database retrieval system