KEGG   Rhizobium gallicum: RGR602_CH01845
Entry
RGR602_CH01845    CDS       T03539                                 

Gene name
dat
Definition
(GenBank) D-alanine aminotransferase
  KO
K00824  D-alanine transaminase [EC:2.6.1.21]
Organism
rga  Rhizobium gallicum
Pathway
rga00310  Lysine degradation
rga00330  Arginine and proline metabolism
rga00360  Phenylalanine metabolism
rga00472  D-Arginine and D-ornithine metabolism
rga00473  D-Alanine metabolism
rga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    RGR602_CH01845 (dat)
   00330 Arginine and proline metabolism
    RGR602_CH01845 (dat)
   00360 Phenylalanine metabolism
    RGR602_CH01845 (dat)
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    RGR602_CH01845 (dat)
   00473 D-Alanine metabolism
    RGR602_CH01845 (dat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rga01007]
    RGR602_CH01845 (dat)
Enzymes [BR:rga01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.21  D-amino-acid transaminase
     RGR602_CH01845 (dat)
Amino acid related enzymes [BR:rga01007]
 Aminotransferase (transaminase)
  Class IV
   RGR602_CH01845 (dat)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-ProteinID: AJD41177
UniProt: A0A0B4X3R7
LinkDB
Position
1828227..1829090
AA seq 287 aa
MPRISYVNGRYVPHADAMVHIEDRGYQFADGVYEVCEIRHGYIVDITRHLDRLNRSLGEL
RITWPMSRQAMIHVIRETARRNKVRNGLFYLQVTRGVARRDHVFPAEGTKPSLVITAKST
DPAVIAKKNANGIKAITVPDNRWDRVDIKTVGLLSNALVRQQAKEAGAQEAIYVDANGCV
KEGAATNVWMVDADGTLITRPAEHGILRGITRTTLMDVAEKLDLRIAERNFTVAEMLAAR
EVFITAATSICFPVVSIDGQTIANGHPGTISQNIREAFFDVAEKIAI
NT seq 864 nt   +upstreamnt  +downstreamnt
atgccgagaatttcctatgtaaatggccgctacgtgccgcacgccgatgcgatggtacat
atcgaagaccgcggctaccagttcgcggacggcgtctacgaggtctgcgaaatacgtcac
ggctacatcgttgatatcacgcgccatctcgaccgcttgaaccgctcgcttggcgagttg
cgtattacctggccgatgagccgccaggcgatgatccatgtgattcgtgaaacggcgcgc
cgcaacaaggtacgcaacggcctgttctatctgcaggtgacgcgcggcgtggcgcgccgc
gaccatgtctttccggccgaaggcaccaagccttcgctggtcatcacggccaaaagcacc
gatcccgcggtcatcgcgaagaaaaacgcaaacggcatcaaggcgatcaccgttccggac
aatcggtgggatcgggttgatatcaagacggtcggtcttctttcgaatgccctggtccgc
cagcaggcgaaggaagccggcgcccaggaggccatctatgtcgatgccaacggctgcgtg
aaagaaggtgccgcgacgaatgtctggatggtcgacgccgacggcaccttgatcacgcgc
cctgccgaacatggtattctgcgcggcatcacgcgcacgacgctgatggatgtcgcggag
aagcttgacctcaggatcgccgagcggaacttcaccgtcgccgaaatgctggcggcacgc
gaggtcttcatcacggccgccacaagcatttgttttcccgtcgtttccatcgacgggcag
acaattgccaacggtcatcccggcacgatctcgcagaatattcgagaagcctttttcgac
gttgcggaaaagattgcgatttga

DBGET integrated database retrieval system