KEGG   Rhizobium gallicum: RGR602_CH02267Help
Entry
RGR602_CH02267    CDS       T03539                                 

Gene name
fabZ-2
Definition
(GenBank) (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase 2
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
rga  Rhizobium gallicum
Pathway
rga00061  Fatty acid biosynthesis
rga00780  Biotin metabolism
rga01100  Metabolic pathways
rga01212  Fatty acid metabolism
Module
rga_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RGR602_CH02267 (fabZ-2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RGR602_CH02267 (fabZ-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rga01004]
    RGR602_CH02267 (fabZ-2)
Enzymes [BR:rga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     RGR602_CH02267 (fabZ-2)
Lipid biosynthesis proteins [BR:rga01004]
 Fatty acid synthase
  Component type
   RGR602_CH02267 (fabZ-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: AJD41594
UniProt: A0A0B4X0Z2
LinkDB All DBs
Position
complement(2234735..2235217)
Genome map
AA seq 160 aa AA seqDB search
MLLEYFQMIDRVEAVDLEKGVLKARSVVPAKSPVFEGHFPGMPLVPGVLLIETMAQASGM
LVLAATDFAAMPFLMSVDGAKMRTFVEPEAVLDIEAFLEHDGSGFAVTKAKITSGGKKVC
DAQLKLRTMPFSEVPLGDIVKKRAVEVGLMDAIAAQGVKG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaatatttccagatgattgaccgcgtggaagcggtcgacctagaaaagggt
gtgctcaaggcgcgttccgttgtgccggcgaaaagccccgtcttcgaaggccattttccg
ggtatgccgctcgttccgggcgtgcttctcattgaaaccatggcgcaggcctcgggcatg
ctggtgctggccgcgactgattttgccgcgatgccgttcctgatgtcggtggacggcgcc
aagatgcgcactttcgtcgagccagaggcggttctcgacatcgaggcgtttctggagcat
gacgggtccggttttgccgtgaccaaggcaaagatcacgagcggcggcaagaaggtctgc
gatgcgcaactgaagttgcgcaccatgcccttcagcgaggttccgctcggcgatatcgtg
aaaaagcgcgcggtcgaggtcggcctgatggatgcaatcgccgcgcagggagtaaaggga
tga

DBGET integrated database retrieval system