KEGG   Rubrivivax gelatinosus: RGE_12120Help
Entry
RGE_12120         CDS       T01803                                 

Definition
(GenBank) glutathione S transferase domain containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RGE_12120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rge02000]
    RGE_12120
Enzymes [BR:rge01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RGE_12120
Transporters [BR:rge02000]
 Other Transporters
  Pores ion channels [TC:1]
   RGE_12120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N_3 GST_N GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: BAL94553
UniProt: I0HNG6
LinkDB All DBs
Position
complement(1257881..1258495)
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIVLLESGLAFHAVMASTKTHRLADGTDYYTINPKGYVPLLELDSG
ERLSEGPAIVQWIADQVPEKKLAPAAGTMARYRLVEWLNFISTELHKGFSPLFTPGMPEE
AKALFRSKLGDRFAYVDAALAEQPFLLGEDFSVADAYLFVVAGWSKHVGVDLSRFAHLAR
FIERVGARPAVQQAMRAEGLIRGG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacagccccggcgcgtgttcgctgtcgccgcacatcgtgctgctcgag
tccggcctggccttccacgcggtgatggccagcaccaagacgcaccgtctggccgacggc
accgactactacacgatcaaccccaagggctacgtgccgctgctcgagctcgacagcggc
gagcgcctcagcgaaggcccggcgatcgtgcaatggatcgccgaccaggtgcccgagaag
aagctcgcgccggccgccggcacgatggcgcgctaccgcctcgtcgagtggctgaacttc
atctcgaccgagctgcacaagggcttttcgccgctgttcacgccgggcatgcccgaagaa
gccaaggcgctgttccgcagcaagctgggcgaccgcttcgcctatgtcgacgcggccctg
gccgagcagcccttcctgctcggcgaggacttcagcgtcgccgacgcctatctcttcgtc
gtcgccggctggtccaagcacgtcggcgtggacctgtcgcgcttcgcccacctggcgcgt
ttcatcgaacgtgtcggcgcgcgtccggcggtgcagcaggcgatgcgggccgaaggcctg
atccgcggcggctga

DBGET integrated database retrieval system