KEGG   Rhodococcus jostii: RHA1_ro04544Help
Entry
RHA1_ro04544      CDS       T00382                                 

Gene name
gabT2
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rha  Rhodococcus jostii
Pathway
rha00250  Alanine, aspartate and glutamate metabolism
rha00410  beta-Alanine metabolism
rha00640  Propanoate metabolism
rha00650  Butanoate metabolism
rha01100  Metabolic pathways
rha01120  Microbial metabolism in diverse environments
Module
rha_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RHA1_ro04544 (gabT2)
   00650 Butanoate metabolism
    RHA1_ro04544 (gabT2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RHA1_ro04544 (gabT2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHA1_ro04544 (gabT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rha01007]
    RHA1_ro04544 (gabT2)
Enzymes [BR:rha01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RHA1_ro04544 (gabT2)
Amino acid related enzymes [BR:rha01007]
 Aminotransferase (transaminase)
  Class III
   RHA1_ro04544 (gabT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABG96330
UniProt: Q0S806
LinkDB All DBs
Position
4789038..4790279
Genome map
AA seq 413 aa AA seqDB search
MTRLSPLLAQATPVTVDHGEGCYLYGTDGRRYLDFTAGIGVTSTGHCHPHVVEAARRQIG
SLIHGQYTTVMHQPMLELVDRLGSVLPAGLDSLFFANSGSEAVEASLRLSRQATGRPNVI
VFHGGFHGRTVATATMTTSGTRFSAGFSPLMGGVHVAPFPNAYRYGWSEEEATAFALKEL
DYIFATLTAPNETAAFVVEPVLGEGGYVPGNTAFFQGLRERADRYGILLVIDEIQTGFGR
TGKFFGHQHFDVRPDIITIAKGLASGFPLSGIAASEALMAKGWPGSQGGTYGGNAVSCAA
AVATLEVIEKEDLVANAAARGVQLLDGARTRAIDGIGDVRGLGLLVGSEFTAADGSADRT
KASAAQQLAAKKGLLLLTCGAHMNVVRMIPPLIVTAEQIEDALKIWSEVLDEV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgactcggctatctccactgctcgcacaggccacacccgtgacggtcgatcacggtgaa
gggtgctacctctacggcaccgacggcaggcgctatctcgacttcaccgcgggcatcggc
gtcaccagtaccgggcactgccacccgcacgtcgtggaggccgcgcgtaggcagatcggc
tccctgatccacggccagtacacgacggtcatgcaccagccgatgctcgaactggtcgat
cggctggggtcggtgctgcccgcggggctcgactcgctgttcttcgcgaactcggggagc
gaggccgtcgaggcgtcgctgcgactgtcgcggcaggcgaccggccgccccaacgtgatc
gtcttccacggcggattccacggacgcacggtcgcgacggcgacgatgaccacgtccggc
acccggttctcggccggcttcagcccgctgatgggcggtgtgcacgtggcaccgttcccc
aacgcctaccgctacggctggtccgaggaggaggcgaccgcgttcgcgctgaaggaactc
gactacatcttcgcgacgctcaccgccccgaacgagacggcggcgttcgtcgtcgagccc
gtcctcggcgagggcggatacgtgcccggcaacaccgcgttcttccaggggctccgcgag
cgcgccgaccgctacggcatcctgctcgtcatcgacgagatccagaccggtttcggccgc
accggcaagttcttcgggcaccagcacttcgacgtccggcccgacatcatcaccatcgcc
aagggtctggccagcggcttcccgctgtcgggcatcgcggcgtccgaggcgctcatggcc
aagggctggccggggtcgcaggggggaacgtacggcggcaacgccgtgtcctgcgcggcc
gcggtcgcgacgctcgaggtgatcgagaaggaagacctcgtggccaacgccgccgcgcgg
ggcgtccagttgctcgacggtgcgcgcacccgggccatcgacgggatcggcgacgtccgt
ggtctcggactgctcgtgggaagcgagttcacggccgccgacggcagcgcggaccgcacg
aaagcgtctgcggcgcagcagctggccgcgaagaaggggctgctgctgttgacctgcggc
gcccacatgaacgtggtacggatgattccaccgctcatcgtgacggcggaacagatcgag
gacgccctgaagatctggtccgaagtactcgacgaagtgtga

DBGET integrated database retrieval system