KEGG   Rodentibacter heylii: FEE42_00305
Entry
FEE42_00305       CDS       T06473                                 

Definition
(GenBank) SDR family oxidoreductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rhey  Rodentibacter heylii
Pathway
rhey00061  Fatty acid biosynthesis
rhey00780  Biotin metabolism
rhey01100  Metabolic pathways
rhey01110  Biosynthesis of secondary metabolites
rhey01212  Fatty acid metabolism
rhey01240  Biosynthesis of cofactors
Module
rhey_M00083  Fatty acid biosynthesis, elongation
rhey_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:rhey00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FEE42_00305
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FEE42_00305
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FEE42_00305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rhey01004]
    FEE42_00305
Enzymes [BR:rhey01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     FEE42_00305
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     FEE42_00305
Lipid biosynthesis proteins [BR:rhey01004]
 Fatty acid synthase
  Component type
   FEE42_00305
SSDB
Motif
Pfam: adh_short_C2 adh_short DUF4570
Other DBs
NCBI-ProteinID: QIA75917
LinkDB
Position
complement(67227..68015)
AA seq 262 aa
MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNEKLQPRVEEFAKEFGSDIV
LPLDVATDESIQNCFAELSKHWDKFDGFVHAIAFAPGDQLDGDYVNAATREGYRIAHDIS
AYSFVAMAQAAHPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKD
GIRVNAISAGPIRTLAASGIKNFKKMLSAFEKTAALRRTVTIEDVGNSAAFLCSDLASGI
TGEIVHVDAGFSITAMGELGEE
NT seq 789 nt   +upstreamnt  +downstreamnt
atgggtttcttaacaggtaaacgaattttagtcactggtctggcaagcaatcgttccatt
gcttacggaatcgcaaaatcaatgaaagagcaaggtgcggaacttgctttcacttatctc
aacgaaaaattacaaccgcgcgtagaagaatttgccaaagaattcggttctgatattgtg
cttcctttagatgtggcaaccgatgaaagtatccaaaactgctttgcagaattaagtaaa
cattgggataaatttgacggtttcgtgcacgccattgcttttgcaccgggcgatcaattg
gacggtgattatgtcaatgccgcaacccgtgagggctaccgtattgctcacgatatcagt
gcatatagctttgtggcaatggcacaagccgcacatccttatttaaatccgaatgctgca
ttactcaccctttcttacttaggggcggaacgtgcaatccctaattacaatgtcatgtgt
ttggcaaaagcctcattagaagcagcaactcgagtaatggctgcggatttaggcaaagac
gggatccgtgttaatgcgatttctgccggcccgattcgtacattagccgcctcaggcatt
aaaaacttcaagaaaatgctttctgcctttgagaaaaccgcagcattacgccgcacagtg
acaatcgaagatgtaggtaactccgctgcgtttttatgttccgatcttgcttccggtatt
acaggcgaaatcgttcatgttgatgccggttttagtatcaccgcaatgggcgaattaggt
gaagaataa

DBGET integrated database retrieval system