KEGG   Sinorhizobium fredii NGR234: NGR_c27850Help
Entry
NGR_c27850        CDS       T00888                                 

Definition
(RefSeq) ATP-dependent DNA ligase protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    NGR_c27850
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rhi03400]
    NGR_c27850
Enzymes [BR:rhi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NGR_c27850
DNA repair and recombination proteins [BR:rhi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     NGR_c27850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-GeneID: 7790439
NCBI-ProteinID: YP_002827285
RhizoBase: NGR_c27850
UniProt: C3MIG9
LinkDB All DBs
Position
2901362..2903959
Genome map
AA seq 865 aa AA seqDB search
MAARSAPLSEYNRRRDFTKTREPKGAVAPASGDRKRFLVQKHDATRLHYDFRLEWEGVLK
SWAVTRGPSLNPEDKRLAIRTEDHPLAYGDFEGTIPEGEYGGGTVMLWDTGWWEPEGDPS
KGLKKGKLSFRLHGSRMKGGWALVRMRPRDGEKRENWLLVKETDEIASEEGESLIKENVT
SVATGRTMDEIAGGKGEKRARVWHSNKSTAANLKAGAIAGNDNPRKRQARKSSGKLPAFK
APQLATLVTKAPAGETWLNEAKFDGYRLICAIGGGAVRCYTRNGLDWTEKFPAIAAALAE
LDCKSALIDGEVVALSDAGSSFSALQKALKTGASTRLYAFDLIELDGKDLGRAPLIDRKE
KLRGLLDSLGTTATVQYSEHVQGNGEHVLAAICKAGQEGIIAKEAKAPYRSGRTRSWLKV
KCTKRQEFVIGGYTPSSKKGRPFASILVGTFEGGKLIYRGGVGTGFGEKVMEELAAAFAK
RSRETPPFDSVPRERMRKAVWLKPDLVAEVDFAEFTADGHVRHGSFEGLREDKEAKAVKL
ETAKPTGAASKAAKGKPSANTGKASSPKGDTDVLGVQISHPDRILFEGQGITKIDLARYY
AVVADRMLTFAADHPVSLVRCPQGGQRHCFFQKHTNDAFPEAIREVPITESSGETENYMY
VHDAKGLVAAVQMGTLEFHIWGATIDKLETPDRLVFDFDPDPSVDFTTVKNAARALRDEL
ADIGLQSFALVTGGKGVHVVVPLVRRASWDDAKSFAKAVAQNIADRDPDHFVATMSKAKR
KGRIFIDWLRNERGATAIAPYSSRAREGGPIATPVGWDELERLSGANTFRIGDILERIEA
DTDPWRDIGKVKQSLTKKMMDSVIK
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcgaagtgcaccgctttccgaatacaatcgacgccgcgattttaccaagacg
cgcgaaccgaagggcgcggtcgccccggcaagcggcgacaggaagcgctttctcgtccag
aagcacgacgcgacccggctgcattacgatttccgtctcgaatgggaaggcgtcctgaag
agctgggcggtcacccgcggtccaagcctcaatccggaggacaagcgcctcgccatccgt
accgaggatcaccccctcgcctatggcgacttcgagggcacgatcccggaaggagagtat
ggcggcggcacggtgatgctctgggacaccggctggtgggagccggaaggtgacccgtcg
aaaggtctgaagaagggcaagctttcgttcaggctgcatggcagccggatgaagggcggc
tgggcgctggtgcgcatgcggccgcgcgacggcgagaagcgcgaaaactggctgctcgtc
aaggagacggacgagatagcctccgaggaaggcgagagcctgatcaaggagaacgtcacc
agcgtggcgaccggccgcacgatggacgagattgccggcggcaagggtgaaaaacgggca
cgcgtctggcattccaacaaaagcacggccgccaatctgaaggccggtgcgatcgccggg
aacgacaaccctcgcaagcgtcaggcacgaaaatcctcgggcaagctgcccgccttcaag
gctccgcagctcgccacgctggtgaccaaagcacccgccggcgaaacgtggctgaacgaa
gccaagttcgacggttaccgcctgatatgcgccatcggtggcggcgctgtccgctgctac
acccgcaatggcctcgactggaccgagaagttcccggcgattgcggccgcccttgccgag
ctcgattgcaaatccgccctgatcgacggcgaggtggtggcgctgtcggacgcgggatca
agcttttcggcgctgcagaaggcgctgaagaccggcgccagcacgaggctctacgccttc
gacctcatcgaactcgacggaaaggacctcggccgcgcgccgctcatcgaccggaaggaa
aagctgagaggtctgctcgactcgctcggtaccacggcgaccgtccagtacagcgagcac
gttcagggcaacggggagcatgtgcttgcggcgatatgcaaggccggccaggagggtatc
atcgccaaggaagcgaaggcgccctatcgcagcggccgcacccgaagctggctcaaggtc
aaatgcaccaagcgtcaggagttcgtcatcggcggctatacaccctcatcgaagaaaggg
cggccgttcgcctccattctcgtcggtactttcgagggcggcaaattgatctatcggggc
ggcgtcggtaccggcttcggcgaaaaggtgatggaggaactcgctgccgcctttgcaaag
cgcagccgcgagacgccgccgttcgacagcgtgccacgagaaagaatgcgaaaagcggtc
tggctgaagccggatctggtggcggaagtggatttcgccgaattcaccgccgacggacat
gtccgccacggctcgttcgagggattgcgcgaggacaaggaggccaaggccgtgaaactg
gaaacagcgaaaccgacaggcgccgcgtcgaaagccgcgaagggcaagccctcggccaat
accggcaaggcgtcgtcgcccaagggcgacaccgatgtcctcggcgtccagatctcgcat
cccgaccgcatcctcttcgaaggtcagggtatcaccaagatcgatcttgcccgctactac
gccgtcgtcgccgacaggatgctgaccttcgccgccgaccatcccgtctcactggtccgc
tgcccccagggcgggcagcggcactgcttcttccagaaacatacgaacgacgctttcccg
gaggcgatccgcgaagtgccgatcaccgagtcctcgggcgaaaccgaaaactacatgtat
gtccatgacgccaagggcctcgtcgccgccgtgcagatgggcacgctcgagttccacatc
tggggcgcgacgatcgacaagctggaaacgcctgaccggttggtcttcgatttcgacccc
gatccgagcgtcgacttcacgaccgtgaagaacgccgcccgcgccctgcgcgacgagctg
gcggacatcggtctgcagtccttcgcgctggtgaccggcggcaaaggcgttcacgtcgtc
gtgccgcttgtccggcgagccagttgggacgacgcgaagagtttcgccaaggccgtggcg
cagaacatcgccgatcgcgatcccgatcatttcgttgccaccatgtcgaaggcgaagcgc
aaggggcggatcttcatcgactggctgagaaacgagcgtggcgccacggcgatcgccccc
tattccagccgcgcccgcgaaggcgggccgatcgccacgccggtcggttgggacgagttg
gaacggctgagcggggccaacaccttccgcatcggcgatatcctcgagcgcatcgaagcg
gacaccgacccgtggcgcgatatcggcaaggtcaagcaatcgctgacaaagaagatgatg
gattcggtcataaaatag

DBGET integrated database retrieval system