KEGG   Rhizobium sp. S41: BA939_19590Help
Entry
BA939_19590       CDS       T05451                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rhv  Rhizobium sp. S41
Pathway
rhv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rhv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BA939_19590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rhv03400]
    BA939_19590
Enzymes [BR:rhv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BA939_19590
DNA repair and recombination proteins [BR:rhv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BA939_19590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ANV26162
LinkDB All DBs
Position
2:1066412..1069063
Genome map
AA seq 883 aa AA seqDB search
MANDKLSTYRQKRDFQKTQEPSGKTKLKASNRRRFVIQKHDATRLHYDLRLELDGVFKSW
AVTKGPSLDPQDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGNRTPE
QALAKGDFKFTLEGERLHGSFVLVRMRNDREGGKRTNWLLIKHRDDFSVDENGAAILDEN
NTSVASGRAMAAIAAGKGKKPKPFMVQSGDVQADAVWDSNHGLAADKRAADTKKKRPASR
KAAKSAMPAFIPPQLCETLERPPSADGWIHEIKFDGYRIQARSENGEVTLKTRKGLDWTA
KYPAIATSAASLPDAIIDGEICALDENGAPDFAALQAALSEGKTDALVYFAFDLLCEGSE
DLRQLPLTERKKRLEALLSEAGEDPRLRFVEHFETGGDAVLKSACKLSLEGIVSKQADAP
YQSGRTDTWAKSKCRAGHEVVIGAYAKTNGKFRSLLVGVFRDDHFVYVGRVGTGYGAKTV
DTILPKLRELETSKSPFTGIGAPKKEPNIVWVKPELVAEIQFAGWTADGLVRQAAFKGLR
EDKPAKEVEAETPASPGKTETPTPARPKPSRPVRGKNTKAEVMGVMISSPDKPLWPDAND
GEPVTKEDLAHYHEAVGPWLIDHIKGRPCSIIRTPDGIGGEQFFQRHAMPGTSNLLELVK
VFGDKKPYLQIDRVEGLAAIAQIGGVELHPWNCEPNEPEVPGRLVFDLDPGPDVPFSTVV
EAAREMRDRLEELGLVSFCKTTGGKGLHVVTPLAVPKGKKLSWPEAKGFAHDVCMQMARD
NPDLYLIKMAKNQRNGRIFLDYLRNDRMATAVAPLSPRARPGAPVSMPLTWKQVKADLDP
KRFTIRTVPALLSKTTAWEDYCDGQRSLEQAIKRLTKSMKQAA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgacaagctttcgacctacaggcagaaacgcgattttcagaaaacgcaggag
ccaagcggaaaaacgaagctgaaagcttcaaaccgcaggcgctttgtcatccagaaacat
gacgccacgcggctccattatgacctgcgcctcgaactcgacggcgtcttcaagtcctgg
gctgtgaccaagggaccgtctcttgatccccaggacaagcgcctggccgtggaggtggaa
gaccacccgctggactatggtgacttcgaaggcacgattcccaaaggccagtatggcggc
ggcacggtcatgctctgggatcgcggctactgggagccggaaggcaacaggacgcccgag
caggctctcgccaagggcgacttcaagtttacccttgaaggagagcggctgcatggcagc
ttcgtgctggtgcggatgcggaacgaccgtgagggtggcaagcggacgaactggctgctg
atcaagcatcgcgacgacttctcggtcgatgaaaacggcgccgccatccttgacgaaaac
aacacgtcggttgcctcgggcagagccatggccgccatcgccgccggtaaaggaaagaaa
ccaaaaccgttcatggtgcagagcggcgatgtgcaggccgacgccgtctgggacagcaat
catggactggcggcagacaaacgtgcggcggatacgaagaaaaagcgcccggcatcgcgg
aaagcagcgaagtccgcgatgcccgccttcatacctccgcagctttgcgaaacgctcgaa
cgcccaccctcggccgatggctggatccacgagatcaaattcgacggataccgtattcag
gcgcgcagtgaaaacggcgaagtcacgctgaagacgcgcaaggggctggactggacggcc
aagtatccggcgattgcgacatcggccgcaagcttgcctgatgccatcatcgacggtgag
atctgtgcgctcgatgaaaacggtgccccggacttcgccgcacttcaggcggcgctgtca
gaaggtaaaacggatgcgctcgtctattttgctttcgacctgctgtgcgaggggagtgag
gatctaaggcaactaccgcttacggaacgcaagaaaaggctcgaagcgcttctgagcgag
gcgggggaagatccgcgcctgcggttcgtcgaacatttcgagaccggtggtgatgcagta
ttgaaatcggcgtgcaagctctcgctggagggcattgtctcgaagcaggcggatgccccc
tatcagtcggggcgcaccgatacctgggcgaaatccaaatgccgcgccggacatgaggtt
gtcattggcgcttacgcgaaaaccaacggcaagtttcgttcacttcttgtcggcgtcttc
agggacgatcacttcgtctatgtcgggcgggtcgggaccggctatggtgccaaaacggtg
gatacaatcctgccgaagctccgggaactggaaacctcaaaatcgccctttaccggaata
ggcgctccgaaaaaggaacccaacatcgtctgggtcaagcccgaactggtggccgagatc
cagttcgccggctggaccgcggacggactggttcgtcaggcagccttcaagggtttgcgc
gaagacaagccggcgaaggaggtcgaggccgaaacgccggcatcgcccgggaaaactgaa
acgccaacgccggcccggccaaagccgtcgcgaccggtacgcggcaagaacaccaaggcc
gaagttatgggcgtgatgatctccagccctgacaagccgctctggcccgatgcaaatgac
ggtgagccggtcaccaaggaggatctcgcgcactatcatgaggccgttggtccatggctg
atcgaccatatcaagggacggccatgctctatcatccggacacctgacggcatcggcggt
gagcagttcttccagagacacgcgatgccgggaacgtcgaacctgctcgaactggtcaag
gtgttcggcgacaagaaaccctatctgcagattgatcgcgttgagggccttgccgccatc
gcccagatcggcggcgtcgaactgcatccctggaattgcgagcccaacgaaccggaggtg
cccggtcgtcttgtcttcgaccttgatccgggtccggacgtacccttctccaccgtggtc
gaagccgcgcgggaaatgcgcgaccggctggaggagcttggcctcgtcagcttctgcaag
accaccggcggcaagggccttcacgtcgtcaccccgcttgcggtaccgaagggaaagaag
ctgagctggccggaggcgaaaggcttcgcacacgatgtctgcatgcagatggcccgtgac
aaccccgacctttacctgatcaagatggccaagaaccagcgcaacggccggatcttcctc
gactacctgcgcaatgaccgaatggcgactgctgttgcgccgctgtcaccgcgcgcccgg
ccaggcgcaccagtatcgatgccactgacctggaaacaggtaaaagcggatcttgatccg
aaacgcttcaccattcgcaccgtaccggcgcttttgtcgaagacaaccgcctgggaggat
tactgcgacgggcagcgttcgctggagcaggccatcaagcggctgacgaagtcgatgaaa
caggccgcctga

DBGET integrated database retrieval system