KEGG   Rickettsia sp. MEAM1 (Bemisia tabaci): BA173_06335Help
Entry
BA173_06335       CDS       T05695                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ric  Rickettsia sp. MEAM1 (Bemisia tabaci)
Pathway
ric00550  Peptidoglycan biosynthesis
ric01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ric00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BA173_06335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ric01002]
    BA173_06335
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ric01011]
    BA173_06335
Enzymes [BR:ric01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BA173_06335
Peptidases and inhibitors [BR:ric01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BA173_06335
Peptidoglycan biosynthesis and degradation proteins [BR:ric01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BA173_06335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ASX28390
UniProt: A0A249E4Z6
LinkDB All DBs
Position
complement(1219409..1220332)
Genome map
AA seq 307 aa AA seqDB search
MFRKILLPYIFVIISLLTQVSEAKKSVKNSSKVPIPVQTSLVINEKNGEVLHAHNSQVRM
YPASLTKLMTLYLMFESIETGKLSLNKKLTVSEKAAKMPPCKLGLKAGETITVRDAINGL
IITSANDAAVVAAENLKGSEKAFAHAMNVKAKQLGMKNTYFKNASGLHDPLQQTTARDMA
KLALAIKKNYPKYYSLFSKTSFVFRGNTRNGHNNVTKNYQGAEGLKTGFTNPSGYNLVTT
ASRNGKSLIAVVTGGRSAGSRDQKMIGLLDQHFNVASTKPKVTLASNNKVKAKPKPKIVI
KKGVMRS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaaaattttattgccttacatttttgttatcatttctttacttacccaagta
agtgaagcaaaaaagtctgtaaaaaattcttctaaagttcctattcccgttcaaactagt
ttagtaattaatgaaaaaaatggtgaggttttgcatgcccataattcacaagttcggatg
tatcccgcctctttaactaaattaatgacgctatatttaatgtttgagtcaattgagaca
ggtaaactatcattaaataaaaagctaaccgtatcagaaaaagcggcaaaaatgcctcct
tgtaagctaggtttaaaagcaggtgaaactataacagtcagagatgctattaatgggtta
attataacttctgctaatgatgctgctgtggttgctgctgaaaaccttaaaggctcagaa
aaagcttttgctcatgcaatgaatgtcaaagctaaacaacttgggatgaaaaatacttat
ttcaaaaatgcttcaggtttgcatgatccgttgcagcaaaccaccgcaagagatatggct
aagcttgctttagcaattaagaaaaactatcctaaatattattcattattttctaaaaca
agctttgtatttcgtggtaacacaagaaatggacataataatgttaccaaaaactatcaa
ggagctgaaggtctaaaaacaggttttactaatccatctggttataatttagttactact
gcctcaagaaacggtaagtcattaatcgcagttgttacaggcggtagaagtgctggatct
cgtgatcagaaaatgatcggattattagatcagcactttaacgtagcatctactaagcct
aaagtcacacttgcttctaacaataaagtaaaagcaaaacctaagccaaaaatagtgata
aaaaaaggagtcatgcgtagttag

DBGET integrated database retrieval system